(data stored in ACNUC7421 zone)

EMBL: CP000247.PE228

CP000247.PE228       Location/Qualifiers
FT   CDS_pept        complement(253892..255238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68268"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A169"
FT                   /protein_id="ABG68268.1"
FT                   /translation="MATMKNKVIWQEGLFALPQHFQQQQRHCEYLLTRRLDAQGDFFWG
FT                   FTELSINTELLAQGKIMIDRAAGCMPDGTVFSIPDQDLLPEPFQPGTLSSKESHNIYLA
FT                   LPVISDVINEIQGLHSAGQGTERYRLTHTRVRDFHTDEGDEQPVGLGQLIPRIVSGADD
FT                   LSAMVTLPLCRILNKNATGALVLDNTFIPTIQAVRVSGLLGAFSGEVQGLLATRAADLA
FT                   GRIGSPEQSGIADVAEFMMLQMLNRYQMQFTHRSQLHTLHPEAFYRDLVGLLGELMTFI
FT                   EGNRLPCTVEPYNHRDLTATFTRTVIPELRRALNTVLVPRAQNLPLFFSEGTWIATIND
FT                   PTLLQSCKLVLAVRARMPYDQVQRQFIQQSKVAATDKIRSVVSVQVPGIPLHTLTAAPR
FT                   QLPYHEGYVYFELEKGTPAWQDVIKAGALALHISGSFPDLNLQLWAIRG"
     atggcaacaa tgaaaaacaa ggtgatctgg caggaagggc tgtttgccct gccgcagcat        60
     tttcagcaac agcagcgtca ctgcgagtac ctgctgaccc gtcgtctgga tgctcagggt       120
     gattttttct ggggctttac ggaactctcc atcaataccg aactgcttgc ccagggcaaa       180
     atcatgattg accgtgcggc gggctgtatg cctgacggca ccgtattcag cattcccgac       240
     caggatctgc tgccggaacc tttccagccg ggaacccttt catcgaaaga gagccacaat       300
     atttatctgg cgctgcctgt aatcagcgac gtgatcaatg aaatccaggg gttgcacagc       360
     gccggtcagg gtacggagcg ttaccgcctc acccataccc gcgtccgtga ttttcacact       420
     gacgaaggcg acgaacagcc ggtcggtctg gggcagttga tccccaggat agtcagcggc       480
     gcagatgatc tcagcgcgat ggtgaccctc cccctgtgcc gtatcctcaa taaaaatgct       540
     accggcgcac tggtgctgga caacaccttt attcccacca ttcaggccgt ccgtgtcagc       600
     gggttgctcg gggcattctc cggcgaggtg cagggactgc ttgccacccg cgccgctgac       660
     ctggccgggc gcattggttc gcctgaacag agcgggatcg ccgatgtggc cgaatttatg       720
     atgttgcaga tgcttaaccg ctatcaaatg cagttcacgc atcgttccca actgcacacg       780
     ctgcatccgg aagccttcta ccgggatctg gtggggctgc tgggagaact gatgaccttt       840
     atcgaaggta atcgcctgcc ctgcaccgtg gagccgtata atcaccggga tcttaccgcg       900
     accttcacca gaaccgtgat cccggaactg cggcgcgcgc tcaataccgt actggtgccg       960
     cgtgcgcaga atctgccgtt gttcttttca gaggggacct ggatcgccac catcaacgat      1020
     cccacattgt tgcagtcctg caagctggta ctggcagtgc gcgccaggat gccctacgac      1080
     caggtacaac gccagttcat ccagcagtcg aaagtggccg ctaccgacaa aatccgcagc      1140
     gtggtcagcg tgcaggtgcc gggtattccg ctgcacacgc ttaccgctgc gccacgtcag      1200
     ttgccatacc acgaaggtta tgtttacttc gaactggaaa aaggcacccc ggcctggcag      1260
     gacgtgataa aagcgggcgc actggcgctg catatctccg gcagcttccc cgatctgaac      1320
     ctccagctct gggctataag gggataa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page