(data stored in ACNUC7421 zone)

EMBL: CP000247.PE230

CP000247.PE230       Location/Qualifiers
FT   CDS_pept        complement(255762..257150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68270"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A187"
FT                   /protein_id="ABG68270.1"
FT                   /translation="MAIRPAPASAEPALLVSRKYRPPSQSESGNNSMEPLMAEEKQQSR
FT                   QASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIRHD
FT                   GAYCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATP
FT                   ETIVMNRDSLADTLLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDP
FT                   IAPRVSRPVAPASDLTGANGINTPFMDLPPGNARHEDGDEFSAMAQYHLAVTPLLRGME
FT                   CPLTLHNSQDADEFLEEAGRALQAAIKGLLSLQQQQNSLSDKHLRPLEDNPLRLDMDYA
FT                   TALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVEALRVMLDAFSPGNLMRR
FT                   FAQYRRSHELRQKMDNAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRVLREKQR
FT                   EPEA"
     ttggcgatcc ggccagctcc cgcctcggca gaaccagctt tattggtcag ccgaaagtac        60
     cgcccgccat cacaatccga atcagggaat aattctatgg aaccacttat ggctgaggaa       120
     aaacagcaat cccgccaggc ctcactgact ttacaggtga tgaatggcaa cgaactggaa       180
     agcggacgcg ccgcaaaatg cctgttcagc gaaaacggcg gtgatattgg ccatacgccg       240
     gaatgtcact ggcaggtaca ggaccgggcg ggaagcattg ctgcgcgtgc ctgtaccgtt       300
     atccggcacg acggagccta ttgcctgcgg tgcctgacgc cgggactgat gattaatctg       360
     gccccggcct cttccgatgc gctcatccgc ctgcgccagg gggatgagat ccagctcggc       420
     gcactggcgc tgaaagtgtt tctgcatgac ggtgcagctg ttacctatga cgagcggatg       480
     gcgaccccgg aaacgattgt aatgaaccgc gacagtctgg cggacaccct gctgaccacc       540
     gagggacaac cggcgtatcc gggaatgccg ttccagcatc agcttgcccc cacggtggcg       600
     cacggttttt ccagcgatcc gctccaggca ctccagacgg aaagcctgat ggtggcagat       660
     gatccgatcg ccccacgcgt ttcccggccc gtagcccccg catccgatct gacaggtgca       720
     aacgggatca acacgccgtt tatggatcta ccgcccggca atgcccgtca tgaggacggc       780
     gatgaatttt ctgccatggc gcagtaccac ctggccgtaa ccccgctgct gcgcggtatg       840
     gagtgtccgc tgacgctgca caattctcag gatgcggatg agtttctcga agaggccgga       900
     cgggcgttgc aggccgccat taagggattg ctgagtctgc aacaacaaca gaatagcctg       960
     tcggataaac acctgcgtcc actggaagac aacccgttgc gccttgatat ggactatgcc      1020
     accgcgctga acgtcatgtt cgccgagggt aaaagcccgg tacatctcgc agcacctgcg      1080
     gccatcgccg aaagcctgcg caacatccgg catcatgaag aggccaaccg ggcggcgatt      1140
     gtggaagcgt tgcgtgtcat gctggacgcc ttctcgccgg gcaacctgat gcgccgcttt      1200
     gcgcaatacc gccgcagcca tgagctgcgc cagaaaatgg acaacgcctg ggcatggcag      1260
     atgtacagca actattacga tgaactggcc tccagccgac agcagggatt tgaaatgctg      1320
     ttcaatgaag tttatgccca ggtctatgac cgggtgctgc gcgaaaaaca gcgggagccg      1380
     gaagcatga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page