(data stored in ACNUC7421 zone)

EMBL: CP000247.PE231

CP000247.PE231       Location/Qualifiers
FT   CDS_pept        complement(257059..258108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68271"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A199"
FT                   /protein_id="ABG68271.1"
FT                   /translation="MAGENGPARPDIATKPPLPADVRNCNFYVLMEALYRRYGTPGQDI
FT                   SLRTEPAREIVRFSSDASIGFPGTDLSALSRSQNGQYVLQTRFLGFSGSQSPLPGYYLD
FT                   QMAQESAQNEDGLKEFLDLFSHRWTQFAYHAWRKYRYYICFRNGGTDTFSQRMYALVGL
FT                   GNQSVRDRLAINHSKMLAYAGILATPGRAPEVICNLVSHCFDLPDVTIERWQLRKVAID
FT                   PAHQNRLGVRNPKGKTAGHIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSFL
FT                   PDGENHLPLTMFLSFILRDQFAWDLRLCLAPQQAKGMRLGDPASSRLGRTSFIGQPKVP
FT                   PAITIRIRE"
     atggcaggag aaaatgggcc agcacgccct gatatagcga caaaaccgcc gttaccggcg        60
     gatgtgcgca actgcaattt ctatgtgctg atggaggcgc tgtaccgtcg gtatggcacg       120
     ccgggccagg acatttccct gcgtaccgag cctgcccggg agatcgtgcg tttcagctct       180
     gacgccagta tcggttttcc gggtacggac ctgagtgcgc tttcccgtag ccagaacgga       240
     cagtatgtac tgcaaacccg gttcctgggt ttttccggca gccagtcgcc gctaccgggc       300
     tattatctgg atcagatggc gcaggagtct gcacagaacg aagacggcct gaaagaattt       360
     ctcgatctat tcagccaccg ctggacacag tttgcctatc atgcctggcg caaataccgc       420
     tactacatct gctttcgtaa cggcggtact gacacctttt cacagcgcat gtacgcactg       480
     gtcgggctgg gtaatcagag cgtgcgtgac aggcttgcca ttaaccacag caaaatgctg       540
     gcctacgccg gaattctggc aacaccaggc cgcgcgccgg aggttatctg taatcttgtg       600
     tcgcactgtt ttgatttgcc ggatgtcacc attgaacgct ggcaactgcg taaagtcgcc       660
     attgatccgg cacaccagaa ccggctgggt gtacgtaatc cgaaaggaaa aacggctgga       720
     catattccgg gacgctccat actcggcgtt aattttaccc tcggcgcacg ggtgccggat       780
     cgcagcggaa aattcctgtt gcagattggc ggcctgtcgc gggagcgtta tctctcattt       840
     ttacccgatg gcgaaaatca cctgccgctg accatgttcc tttcctttat tctgcgcgac       900
     cagtttgcct gggatttacg gctgtgcctg gcaccacagc aggctaaagg gatgcgcctt       960
     ggcgatccgg ccagctcccg cctcggcaga accagcttta ttggtcagcc gaaagtaccg      1020
     cccgccatca caatccgaat cagggaataa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page