(data stored in ACNUC7421 zone)

EMBL: CP000247.PE240

CP000247.PE240       Location/Qualifiers
FT   CDS_pept        268346..268636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A197"
FT                   /protein_id="ABG68280.1"
FT                   /translation="MGIVFTNHNIDLLSVEFDEITKNCNYTFSVDGETAIFTARISIIR
FT                   NIKGIKYSEELDKFIMSIMPLQPKVSKILGGVTWDCICGKEVGFPVRLIGK"
     atgggcatag tgtttacaaa ccataatatt gatttgttat cggttgaatt tgatgagatt        60
     acaaaaaatt gtaattacac ttttagtgta gatggagaga cggctatctt tactgctaga       120
     atatcaataa taagaaatat aaagggaatt aaatatagcg aagaacttga taaatttata       180
     atgtcaataa tgccattgca gcctaaagta tcaaaaattt tgggaggtgt tacttgggat       240
     tgtatttgtg gtaaggaagt tggatttcct gtgagattaa ttggtaagtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page