(data stored in ACNUC7421 zone)

EMBL: CP000247.PE243

CP000247.PE243       Location/Qualifiers
FT   CDS_pept        269887..270390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68283"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1B8"
FT                   /protein_id="ABG68283.1"
FT                   /translation="MVDIVEADKTDIYFIQESVYGKIGLPAFGNTIGPSAQQVVKKVFA
FT                   VVKERDKTHAKQRLLLEYNGNKLWMNAIDGSEAILPTEFSKRYELSLFNTTNFGEDPFP
FT                   DVNLYNNMKSSFFVRFGGTSHPEAWAIYNASTKEVKYIETAREIDKIFSDFNLSGTLPI
FT                   HIGQ"
     atggtagata ttgtcgaggc cgataaaacg gatatttatt tcattcagga gagtgtttat        60
     ggcaaaatcg ggttgccagc ttttggtaat acaataggac catccgcaca gcaagttgtt       120
     aaaaaggtat tcgctgtcgt taaagaacga gataagacac atgcaaaaca gagattattg       180
     ttggaatata atggtaacaa actctggatg aatgctattg atggcagtga agctatccta       240
     ccaacagaat tttctaagcg atacgaactt tcattattca atactactaa ttttggagaa       300
     gatccttttc ctgatgttaa tttatataat aatatgaaat caagtttttt tgtaaggttt       360
     ggtggaacat cccatcccga ggcttgggct atttataatg caagtacgaa agaggttaaa       420
     tatatagaaa ctgcaagaga aattgataaa atattcagtg attttaactt gagtggtaca       480
     ttgccaattc acattggtca atga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page