(data stored in ACNUC7421 zone)

EMBL: CP000247.PE244

CP000247.PE244       Location/Qualifiers
FT   CDS_pept        270484..270972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68284"
FT                   /db_xref="InterPro:IPR021300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A171"
FT                   /protein_id="ABG68284.1"
FT                   /translation="MLKMSLYVIILLFSLQFSAAITGKESEVVSPLLMDVNPSLTMENI
FT                   SELSTSSEPSQQGVFPVICTRLHPGSVMKRQLLTGWGPVFIIGDDPFSLRWMSEHLEIL
FT                   KSLNALGLVVNVESVERMEVLQQRADGLLLLPVICDNFVQALQLNAYPVLITEMEISQ"
     atgttaaaaa tgagtttata cgtaataata ttgttatttt cccttcagtt tagtgcagcc        60
     attactggca aggaaagtga ggttgtttca ccattattaa tggatgttaa tccttcacta       120
     acaatggaaa atatttctga attatccaca tcatcggaac catcgcaaca gggggtattt       180
     cctgtaatat gtactcgact tcatcctggc tccgtaatga aacgtcagtt attaaccggc       240
     tgggggcctg tttttataat tggtgatgat cctttttctc tgcgctggat gagtgaacat       300
     ctggagatcc ttaaatcgct aaatgccctt ggtttggttg ttaatgttga atcagtagaa       360
     cgaatggagg tattacagca gcgggctgat gggttattgt tattgccagt tatctgcgat       420
     aattttgtgc aagctctgca attaaatgct tatccggtat taatcacaga gatggaaata       480
     tcacaatga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page