(data stored in ACNUC7421 zone)

EMBL: CP000247.PE252

CP000247.PE252       Location/Qualifiers
FT   CDS_pept        278865..279362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68292"
FT                   /db_xref="GOA:A0A454A1B7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1B7"
FT                   /protein_id="ABG68292.1"
FT                   /translation="MSEYRRYYIKGGTWFFTVNLQNRRNQLLTTQFQTLRNVIIKVKRD
FT                   RPFEINAWVVLPEHMHCIWTLPEGDDDFSSRWREIKKQFTHACGLKNIWQPRFWEHAIR
FT                   NTKDYRHHVDYIYINPVKHGWVKQVSDWPFSTFHRDVAKGLYPIDWAGDVTDFSAGERI
FT                   IL"
     atgtctgaat atcgtcgtta ttacatcaag gggggaacct ggtttttcac ggtaaattta        60
     cagaatcgtc gaaaccaact tttgaccacc cagtttcaga cgctccgtaa cgttattatt       120
     aaagttaagc gagacagacc ttttgaaatt aacgcttggg tagttttgcc ggagcatatg       180
     cattgcatat ggacattacc tgaaggcgat gatgattttt cctcgcgctg gcgggaaatt       240
     aaaaagcaat ttacccatgc ttgtggattg aaaaatatct ggcaaccacg tttttgggaa       300
     catgctatcc gcaataccaa agactatcgc catcatgttg attatattta tataaatcca       360
     gtaaaacatg gttgggtaaa acaagtgagt gattggccat tctcaacgtt tcaccgcgat       420
     gttgcgaaag ggttatatcc catcgattgg gcgggagacg taacggattt tagtgctggg       480
     gagcgtatca ttttatag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page