(data stored in ACNUC7421 zone)

EMBL: CP000247.PE261

CP000247.PE261       Location/Qualifiers
FT   CDS_pept        285811..286425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0265"
FT                   /product="putative peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68301"
FT                   /db_xref="GOA:A0A454A1C2"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR017509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1C2"
FT                   /protein_id="ABG68301.1"
FT                   /translation="MILLQLSSAQGPEECCLAVKKALDRLIKEATRQDVAVTVLETETG
FT                   RYSDTLRSALISLDGDNAWALSESWCGTIQWICPSPYRPHHGRKNWFLGIGRFTADEQE
FT                   QSDAIRYETLRSSGPGGQHVNKTDSAVRATHLSSGISVKVQSERSQHANKRLARLLIAW
FT                   KLEQQQQENSAALKSQRRMFHHQIERGNPRRTFTGMAFIEG"
     atgatcttgc tacaactctc ctctgctcag gggccggaag aatgttgtct cgcagtgaaa        60
     aaagcactgg acaggctgat taaagaagct acccgacagg acgtcgcggt aacggtgctg       120
     gaaacagaaa cgggtcgcta ctctgacaca ctgcgttcgg cgctgatttc tctggatggc       180
     gataacgcat gggctttaag cgaaagctgg tgcggcacta ttcagtggat ttgtccgagt       240
     ccgtatcggc ctcatcatgg gcgcaaaaac tggtttctgg gcattgggcg ttttaccgct       300
     gatgagcagg aacaatcgga tgcaatccgt tatgagacgc tgcgttcgtc agggccgggc       360
     ggtcaacatg tcaataaaac cgactcggcg gtacgcgcca cgcatctgtc atccggtatt       420
     agcgtgaagg ttcagtcaga gcgcagtcag catgctaaca aacggctggc gcgattactg       480
     attgcctgga agctggaaca acagcaacag gaaaatagcg cggcgctgaa atcgcagcgg       540
     cgaatgttcc atcaccagat tgaacgtggc aacccgcgac gaacgttcac agggatggct       600
     tttatcgaag gataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page