(data stored in ACNUC7421 zone)

EMBL: CP000247.PE27

CP000247.PE27        Location/Qualifiers
FT   CDS_pept        27803..28768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0027"
FT                   /product="LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68069"
FT                   /db_xref="GOA:Q0TLW2"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TLW2"
FT                   /protein_id="ABG68069.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGS
FT                   KNSSNSNRLAELAQRMGKRAFLIDDATDIQEEWVKEAKCVGVTAGASAPDILVQNVVAR
FT                   LRSLAVAKPFRWKAAKKISFSKCRKSCESIFVKSIKSLAA"
     atgcagatcc tgttggccaa cccgcgtggt ttttgtgccg gggtagaccg cgctatcagc        60
     attgttgaaa acgcgctggc catttacggc gcaccgatat atgtccgtca cgaagtggtg       120
     cataaccgct acgtggtcga tagcctgcgc gagcgtgggg ctatctttat tgagcagatt       180
     agcgaagtac cggacggcgc gatcctgatt ttctccgcac acggtgtttc tcaggcggta       240
     cgtaatgaag cgaaaagccg tgatttgacg gtatttgacg ccacctgtcc gctggtgacc       300
     aaagtgcata tggaagtcgc ccgcgccagc cgtcgtggtg aagaatctat tctcatcggt       360
     cacgccgggc acccggaagt ggaagggacg atgggccagt acagcaaccc ggaaggggga       420
     atgtatctgg tcgaatcgcc agacgatgtg tggaaactga cggtcaaaaa cgaagagaag       480
     ctctccttta tgacccaaac cacgctgtcg gtggatgaca cgtctgatgt gatcgacgcg       540
     ctgcgtaaac gcttcccgaa aattgtcggt ccgcgcaaag atgacatctg ctacgccacg       600
     actaaccgtc aggaagcggt acgcgccctg gcagagcagg cggaagtagt actggtggtt       660
     ggttcgaaaa actcttccaa ctccaaccgt ctggcggaac tggcccagcg tatgggcaaa       720
     cgcgcgtttt tgattgacga tgcgacagat atccaggaag agtgggtgaa agaggcgaaa       780
     tgcgtcggcg tgactgctgg cgcatcagct ccggatattc tggtacagaa cgtagtcgca       840
     cgtttacgca gcttggcggt ggcgaagcca ttccgctgga aggccgcgaa gaaaatatcg       900
     ttttcgaagt gccgaaagag ctgcgagtcg atattcgtga agtcgattaa gtcattagca       960
     gcctaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page