(data stored in ACNUC7421 zone)

EMBL: CP000247.PE277

CP000247.PE277       Location/Qualifiers
FT   CDS_pept        302813..302992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68317"
FT                   /db_xref="GOA:A0A454A1B4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1B4"
FT                   /protein_id="ABG68317.1"
FT                   /translation="MNGRSVITLTLIFLLGVAVFLIYHLQWMYLPGYYLWGLCVCILSN
FT                   QLALMLHSLALLGK"
     atgaatggca gaagtgttat cactctgaca ttaatatttt tattaggagt tgcagtattt        60
     ctaatatacc atctccaatg gatgtatctt ccagggtatt atctgtgggg cctatgtgta       120
     tgtatattgt caaaccagtt agctcttatg cttcattccc tagcccttct tggcaaatga       180
//

If you have problems or comments...

PBIL Back to PBIL home page