(data stored in ACNUC7421 zone)

EMBL: CP000247.PE280

CP000247.PE280       Location/Qualifiers
FT   CDS_pept        304806..305861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0285"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68320"
FT                   /db_xref="GOA:A0A454A1D3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1D3"
FT                   /protein_id="ABG68320.1"
FT                   /translation="MVYVLIRLVTYGYYRQISEETLVRGARASSYFMESLYGIATVKIQ
FT                   GMVGIRGTHWLNLKIDAINSGIKLTRMDLLFGGINTFVAACDQMAILWLGASLVIDNQM
FT                   TIGMFVAFGSFRGQFSDRVASLTSFLLQLRIMSLHNERIADIALHEKEEKKPEIEIVAD
FT                   MSPVSLETTDLSYRYDSQSAQVFSGLNLSVAPGESVAITGASGAGKTTLMKVLCGLFEP
FT                   DSGKVLVNGTDIRQLGINNYHRMIACVMQDDRLFSGSIRENICGFAEETDDEWMTECAR
FT                   ASHIHDVIMKMPMGYETLIGELGEGLSGGQKQRIFIARALYRKPGILFMDEATSSLDTE
FT                   SERFVNAAIKK"
     atggtttacg ttcttattcg tctggtgaca tacggctatt accggcaaat atcggaagaa        60
     actcttgtca ggggggcccg ggccagctcc tattttatgg aaagcctgta tggtattgcc       120
     acggtaaaaa tccagggtat ggtcgggatc cggggaacac actggcttaa cctgaaaata       180
     gatgcgatca attcaggtat taagttaacc aggatggatt tgctcttcgg gggaataaat       240
     acttttgttg ccgcctgtga tcagatggcg attttatggc tgggtgcaag ccttgtgatc       300
     gataatcaga tgacaatagg gatgtttgtg gcatttggtt cttttcgtgg gcagttttcg       360
     gatcgggttg cttcgctgac cagttttctt cttcaactga gaataatgag tctgcataat       420
     gagcgcattg cagatattgc actacatgaa aaggaagaaa agaaaccgga aattgaaatc       480
     gttgctgaca tgagcccggt ttcactggaa accactgatt taagctaccg gtatgacagc       540
     cagtcagcac aggtattcag tggtctgaat ttgtctgtgg ctccgggaga aagtgtggct       600
     ataactggtg cctccggtgc cggaaaaacc acattaatga aagtattatg tggactgttt       660
     gaaccagata gtggaaaagt actggttaat ggcacggata tacgtcaact tggaataaat       720
     aattatcacc gtatgatagc ctgtgttatg caggacgacc ggctattttc aggatcaatt       780
     cgtgaaaata tctgtgggtt tgcagaagaa acagacgacg aatggatgac agaatgtgcc       840
     agagcaagtc atattcatga tgtgataatg aaaatgccaa tggggtatga aacgttaata       900
     ggtgaactgg gggaaggtct ttccggcggt caaaaacagc gtatattcat tgcccgagct       960
     ttataccgga aacctggaat attatttatg gatgaggcta caagttctct tgatacagaa      1020
     agtgaacgtt tcgtgaatgc tgccataaaa aaatga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page