(data stored in ACNUC7421 zone)

EMBL: CP000247.PE283

CP000247.PE283       Location/Qualifiers
FT   CDS_pept        complement(307422..307892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0288"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68323"
FT                   /db_xref="GOA:A0A454A1F1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1F1"
FT                   /protein_id="ABG68323.1"
FT                   /translation="MSCYMKIYWTRKSIPELSALPPSLRKKNFTDAYNAASSHIEYWIG
FT                   AGVSFISMMILFRVYDFLLPAQDTFPGDIIRSLCVVCPSILIWFQFSVYVMRKYYRHIL
FT                   ERGKETETISERLIREADTREYELWRPVRRFFSIIFLIVLLVCIHSLITTIK"
     atgagttgct atatgaaaat atactggaca agaaaaagca ttcctgaact ttcagcactt        60
     ccaccttcat taagaaagaa aaattttact gacgcatata atgctgcatc ttcccatatc       120
     gaatactgga taggtgctgg cgtctcattt atctcgatga tgattttatt cagagtatat       180
     gactttcttt tacccgccca agatactttc cctggtgata tcatcagaag tttatgtgtt       240
     gtgtgtccat ccatattaat ctggtttcag ttttcggtat atgtcatgag gaaatattac       300
     agacatattc tggaacgagg taaggaaacc gaaaccattt cagaaaggtt gatacgtgag       360
     gctgatacac gagaatatga actatggcgt ccggtccgtc gctttttctc cattattttt       420
     ctcattgttc tattagtttg cattcattca ctgataacaa ctataaaata a                471
//

If you have problems or comments...

PBIL Back to PBIL home page