(data stored in ACNUC7421 zone)

EMBL: CP000247.PE286

CP000247.PE286       Location/Qualifiers
FT   CDS_pept        complement(309936..310157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0291"
FT                   /product="fimbrial transcription regulator protein FaeA"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68326"
FT                   /db_xref="GOA:A0A454A1B6"
FT                   /db_xref="InterPro:IPR006793"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1B6"
FT                   /protein_id="ABG68326.1"
FT                   /translation="MQNEIMGFLSRHNVGKTAEIAEALAVTDYQARYYLLLLEKEGMVQ
FT                   RSPLRRGMATYWFLKGEMQAGQSCSSTT"
     atgcagaatg aaataatggg ttttctgagc agacataatg tagggaaaac cgcagaaatt        60
     gcggaggcgc tggcggtaac ggattatcag gcacgctatt acctgttatt actggaaaaa       120
     gaaggtatgg ttcagcgctc tccattaagg cgaggcatgg caacatactg gtttctgaaa       180
     ggagagatgc aggcgggaca gagctgttct tccacaactt aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page