(data stored in ACNUC7421 zone)

EMBL: CP000247.PE292

CP000247.PE292       Location/Qualifiers
FT   CDS_pept        315887..316411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0297"
FT                   /product="F1C minor fimbrial subunit F precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68332"
FT                   /db_xref="GOA:P13429"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13429"
FT                   /protein_id="ABG68332.1"
FT                   /translation="MKDIIKTVTFSCMLAGSMFVTCHVCAAGSVVNITGNVQDNTCDVD
FT                   INSRNFDVSLGSYDSRQFTAAGDTTPASVFHVGLTSCGSAVRAVKLTFTGTPDNQEAGL
FT                   IQINSINGARGVGIQLLDKDKHELKINVPTTIALMPGTQTIAFYARLKATYLPVKAGNV
FT                   DAVVNFVLDYQ"
     gtgaaggata ttattaaaac agtgacattc tcctgcatgc tggccggcag tatgttcgtt        60
     acctgtcatg tctgtgcagc gggttctgtg gtgaatatta caggcaatgt tcaggataac       120
     acctgcgatg ttgacattaa ctcccgaaac tttgatgtca gtctgggaag ttatgacagc       180
     cgacagttta ccgcagctgg tgataccaca cctgcgtcgg tatttcatgt cgggttaacc       240
     tcctgcggca gtgctgtccg tgcagtgaag ctgacattta cgggcacacc agataatcag       300
     gaggcggggc ttattcagat taacagcata aatggagcac ggggtgtggg gattcagctt       360
     cttgataagg ataaacatga gctgaaaatt aatgtgccga caacaattgc gttaatgccg       420
     ggaacacaga ccatagcgtt ttatgcccgt ctgaaagcca cttatcttcc ggtaaaggcc       480
     ggtaatgttg atgcggtggt taattttgta cttgactatc agtaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page