(data stored in ACNUC7421 zone)

EMBL: CP000247.PE297

CP000247.PE297       Location/Qualifiers
FT   CDS_pept        320121..322298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0302"
FT                   /product="TonB dependent outer membrane siderophore
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68337"
FT                   /db_xref="GOA:A0A454A1C7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1C7"
FT                   /protein_id="ABG68337.1"
FT                   /translation="MRINKILWSLTVLLVGLNSQVSVAKYSDDDNDETLVVEATAEQVL
FT                   KQQPGVSVITSEDIKKTPPVNDLSDIIRKMPGVNLTGNSASGTRGNNRQIDIRGMGPEN
FT                   TLILIDGVPVTSRNSVRYSWRGERDTRGDTNWVPPEQVERIEVIRGPAAARYGSGAAGG
FT                   VVNIITKRPTNDWHGSLSLYTNQPESSEEGATRRANFSLSGPLAGDALTTRLYGNLNKT
FT                   DADSWDINSPVGTKNAAGHEGVRNKDINGVISWKLNPQQILDFEAGYSRQGNIYAGDTQ
FT                   NSSSSAVTESLAKSGKETNRLYRQNYGITHNGIWDWGQSRFGIYYEKTNNTRMNEGLSG
FT                   GGEGRILAGEKFTTNRLSSWRTSGELNIPLNVMVDQTLTVGAEWNRDKLDDPSSTSLTV
FT                   NDRDISGISGSAADRSSKNHSQISALYIEDNIEPVPGTNIIPGLRFDYLSDSGGNFSPS
FT                   LNLSQELGDYFKVKAGVARTFKAPNLYQSSEGYLLYSKGNGCPKDITSGGCYLIGNKDL
FT                   DPEISVNKEIGLEFTWEDYHASVTYFRNDYQNKIVAGDNVIGQTASGAYILKWQNGGKA
FT                   LVDGIEASMSFPLVKDRLNWNTNATWMITSEQKDTGNPLSVIPKYTINNSLNWTITQAF
FT                   SANVNWTLYGRQKPRTHAETRSEDTGGLSGKELGAYSLVGTNFNYDINKNLRLNVGVSN
FT                   ILNKQIFRSSEGANTYNEPGRAYYAGVTASF"
     atgagaatta acaaaatcct ctggtcgcta actgtgctcc tggttgggtt gaatagccag        60
     gtatcagtag ccaaatactc cgacgatgat aatgacgaga ctctggtggt ggaagccacc       120
     gctgagcagg tattaaaaca gcagccgggc gtgtcggtta ttaccagcga ggatattaaa       180
     aagacccctc cggtaaacga cctttcagat attattcgta aaatgcctgg tgtcaatctt       240
     accggcaata gcgcctcggg cacacgcggt aataaccgcc agatcgatat tcgtggtatg       300
     gggccggaaa acaccttaat tttaattgat ggtgtaccgg tgacgtcacg taactccgtg       360
     cgttatagct ggcgtgggga gcgtgatacc cgcggtgaca ccaactgggt gccaccggaa       420
     caggttgagc gtattgaagt gatccgcggc cctgcggcgg cgcgctacgg ttcgggggcc       480
     gccggggggg tggtgaacat cattaccaaa cgtcccacca acgactggca cggttcgctg       540
     tcgttataca ccaaccagcc ggaaagtagc gaagagggcg ctacgcgtcg cgccaatttc       600
     agccttagtg ggcctctggc tggtgatgct cttaccacgc gtttgtatgg taacctgaat       660
     aaaacggatg ctgacagttg ggatattaat tctccggtcg gtacgaaaaa cgcagccggg       720
     catgaagggg tacgtaacaa agatattaac ggcgttatct cgtggaaatt aaatccgcag       780
     cagattctcg atttcgaagc cggatatagc cgccagggga atatctatgc gggcgatacg       840
     cagaacagtt cttccagtgc agttaccgaa agcctggcaa aatccggcaa agagacgaac       900
     cgcctgtacc gacagaatta tggcattacg cataatggta tctgggactg gggacaaagt       960
     cgctttggta tttattacga gaaaaccaat aatacccgca tgaatgaagg attatccggc      1020
     ggtggtgaag gacgtatttt agcgggtgaa aagtttacga ccaatcgcct gagttcctgg      1080
     cgaaccagcg gtgagcttaa tattcctttg aatgtgatgg ttgatcaaac gctgaccgtt      1140
     ggtgcagagt ggaaccgcga taagctcgat gatccttcct ctaccagcct gacggtgaat      1200
     gacagagata tcagcggtat ttctggctct gctgcggatc gcagcagtaa aaatcattct      1260
     caaatcagtg cgctgtatat tgaagataac attgagccgg ttcctggcac gaatatcatt      1320
     cccggcctgc gctttgatta tctcagcgac tccggcggga acttcagccc cagtctgaat      1380
     ctttcgcagg aattgggcga ttatttcaaa gtcaaagcag gggttgcccg aacctttaaa      1440
     gccccaaacc tgtatcaatc cagtgaaggc tatctgctct actcgaaagg caatggctgt      1500
     ccaaaagata ttacctcagg cgggtgctac ctgatcggta ataaagatct cgatccggaa      1560
     atcagcgtca ataaagaaat tggactggag ttcacctggg aagattacca cgcaagtgtg      1620
     acctacttcc gcaatgatta ccagaataag atcgtggccg gggataacgt tatcgggcaa      1680
     accgcttcag gcgcatatat cctcaagtgg cagaatggcg ggaaagctct ggtggacggt      1740
     atcgaagcca gtatgtcttt cccactggtg aaagatcgtc tgaactggaa taccaatgcc      1800
     acatggatga tcacttcgga gcaaaaagac accggtaatc ctctgtcggt catcccgaaa      1860
     tatactatca ataactcgct taactggacc atcacccagg cgttttctgc caacgtcaac      1920
     tggacgttat atggcagaca aaaaccgcgt actcatgcgg aaacccgcag tgaagatact      1980
     ggcggtctgt caggtaaaga gctgggcgct tattcactgg tggggacgaa cttcaattac      2040
     gatattaata aaaatctgcg tcttaatgtc ggcgtcagta atatcctcaa taaacagatc      2100
     ttccgatctt ctgaaggggc gaatacctat aacgagccag gccgggctta ttatgccgga      2160
     gttaccgcat cattctga                                                    2178
//

If you have problems or comments...

PBIL Back to PBIL home page