(data stored in ACNUC7421 zone)

EMBL: CP000247.PE298

CP000247.PE298       Location/Qualifiers
FT   CDS_pept        complement(322343..323299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0303"
FT                   /product="IroE protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68338"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1D2"
FT                   /protein_id="ABG68338.1"
FT                   /translation="MYAREYRSTRPHKAIFFHLSCLTLICSAQVYAKPDMRPLGPNIAD
FT                   KGSVFYHFSATSFDSVDGTRHYRVWTAVPNTTAPASGYPILYMLDGNAVMDRLDDELLK
FT                   QLSEKTPPVIVAVGYQTNLPFDLNSRAYDYTPAAESRKTDLHSGRFSRKSGGSNNFRQL
FT                   LETRIAPKVEQGLNIDRQRRSLWGHSYGGLFVLDSWLSSSYFRSYYSASPSLGRGYDAL
FT                   LSRVTAVEPLQFCAKHLAIMEGSATQGDNRETHAVGVLSKIHTTLTILKDKGVNAVFWD
FT                   FPNLGHGPMFNASFRQALLDISGENANYTAGCHELSH"
     atgtatgccc gcgagtatcg ctcaacacgc ccgcataaag cgattttctt tcatctttct        60
     tgcctcaccc ttatctgtag tgcgcaagtt tatgcgaagc cggatatgcg gccactgggg       120
     ccgaatatag ccgataaagg ctccgtgttt taccatttca gcgccacctc tttcgactct       180
     gtcgatggca cacgccatta tcgggtatgg acggccgtgc cgaatacaac cgcaccggca       240
     tcgggttacc cgattttata tatgcttgac ggtaacgcag ttatggaccg cctggatgac       300
     gaactgctca aacaattgtc agaaaaaaca ccgccagtga tcgtggctgt cgggtatcag       360
     accaacctcc ctttcgatct caacagcagg gcttacgact atacgccagc agcagaaagc       420
     agaaaaacag atctccactc agggcgtttt agccgtaaga gtggtggcag caacaacttc       480
     cgccagttac tggaaacgcg tattgcccca aaagtggaac agggactgaa tatcgatcgg       540
     caacgccgca gcttatgggg gcactcctac ggcggcctct tcgtgctgga ttcctggctg       600
     tcctcctctt acttccggtc gtactacagc gccagcccgt cgttgggcag aggttatgat       660
     gctttgctaa gccgcgttac ggcggttgag cctctgcaat tctgcgccaa acacctggcg       720
     ataatggaag gctcggcgac acagggtgat aaccgggaaa cgcatgctgt cggggtgctg       780
     tcgaaaattc ataccaccct cactatactg aaagataaag gcgtcaatgc cgtattttgg       840
     gatttcccca acctgggaca cgggccgatg ttcaatgcct cctttcgcca ggcactgtta       900
     gatatcagtg gtgaaaacgc aaattacaca gcaggttgtc atgagttaag ccactaa          957
//

If you have problems or comments...

PBIL Back to PBIL home page