(data stored in ACNUC7421 zone)

EMBL: CP000247.PE308

CP000247.PE308       Location/Qualifiers
FT   CDS_pept        334467..336431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0314"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68348"
FT                   /db_xref="GOA:A0A454A1E0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1E0"
FT                   /protein_id="ABG68348.1"
FT                   /translation="MNVIRTVICTLIILPVGLQAATSHSSMVKDTITIVATGNQNTVFE
FT                   TPSMVSVVTNDTPWSQNAVTSAGMLKGVAGLSQTGAGRTNGQTFNLRGYDKSGVLVLVD
FT                   GVRQLSDMAKSSGTYLDPALVKRIEVVRGPNSSLYGSGGLGGVVDFRTADAADFLPPGE
FT                   TNGLSLWGNIASGDHSTGSGLTWFGKTGKTDALLSVIMRKRGNIYQSDGEHAPNKEKPA
FT                   ALFAKGSVGITDSNKAGASLRLYRNNTTEPGNSTQTHGDSGLRDRKTVQNDVQFWYQYA
FT                   PVDNSLINVKSTLYLSDITIKTNGHNKTAEWRNNRTSGVNVVNRSHTLIFPGAHQLSYG
FT                   AEYYRQQQKPEGSATLYPEGNIDFTSLYFQDEMTMKSYPVNIIVGSRYDRYKSFNPRAG
FT                   ELKAERLSPRAAISVSPTDWLMMYGSISSAFRAPTMAEMYRDDVHFYRKGKPNYWVPNL
FT                   NLKPENNITREIGAGIQLDGLLTDNDRLQLKGGYFGTDARNYIATRVDMKRMRSYSYNV
FT                   SRARIWGWDMQGNYQSDYVDWMLSYNRTESMDASSREWLGSGNPDTLISDISIPVGHRG
FT                   VYAGWRAELSASATHVKKGDPHQAGYTIHSFSLSYKPVSVKGFEASVTLDNAFNKLAMN
FT                   GKGVPLSGRTVSLYTRYQW"
     atgaatgtaa tcagaactgt catttgtaca ttaattatac ttccggtggg actacaggca        60
     gcgaccagtc attcttctat ggttaaagat acaatcacca ttgtcgcgac aggaaatcag       120
     aacacggtat ttgaaacgcc gtcgatggtc agtgtcgtca cgaatgacac accgtggagt       180
     cagaatgcgg ttacatcggc cggcatgctg aaaggtgttg ccggtctcag ccagactggt       240
     gcaggacgga ccaatgggca gacctttaat ttacgcggct atgacaaaag cggggtactt       300
     gttcttgttg acggcgttcg ccaactcagt gacatggcaa aaagcagtgg cacttatctg       360
     gatccggcac tcgtcaaacg tatcgaagtt gtccgcgggc caaactccag tctgtacggc       420
     agtggcgggc tgggaggtgt agtggacttc agaactgccg atgcagcaga ttttcttccc       480
     cccggagaga caaacggttt aagtctgtgg ggaaatattg ccagtggtga ccacagcaca       540
     ggctcggggc tcacctggtt tggtaaaact ggaaaaacag atgcgctcct ttctgtcatt       600
     atgcgtaaaa gaggtaatat ctatcaaagt gatggtgagc acgcacctaa caaggaaaaa       660
     cctgcagccc tgtttgcgaa aggctctgtc ggtataacag acagtaacaa agcaggtgcc       720
     agcttgcgtc tctaccggaa taacaccact gaaccgggca attccactca gacacatggt       780
     gacagcggtc tgcgtgacag aaaaacagta caaaatgacg tacagttctg gtaccagtac       840
     gctcctgtgg ataacagcct catcaatgta aagtcaacgt tatatctcag tgatatcact       900
     atcaagacaa acggtcacaa caaaacggca gaatggagaa acaacagaac ctccggtgtt       960
     aatgttgtca acaggagtca tactctgatt tttccgggag cccatcagtt aagttatggc      1020
     gctgaatatt accgtcagca gcagaagcca gaaggctctg ccacactata tccggaagga      1080
     aacattgact ttacatcgtt gtatttccag gatgaaatga caatgaaaag ctacccggtt      1140
     aacattatcg tcggttcccg ctatgaccgg tacaagagct tcaatccccg tgccggagaa      1200
     ctgaaagccg aacgcctgtc cccaagggcg gcgatttcag tctcaccgac agactggctg      1260
     atgatgtacg gctccatatc ctctgcattc cgagcgccca caatggcaga aatgtacagg      1320
     gatgatgtac atttttaccg caagggtaaa cccaattact gggttcctaa ccttaatctg      1380
     aaaccagaaa ataacatcac ccgtgagatt ggcgcaggta ttcaactgga tggcctgctt      1440
     acagacaatg accggctgca gttaaaaggc ggatatttcg gaacggatgc cagaaactat      1500
     attgccacac gcgtggatat gaaacggatg cgttcttatt cttataatgt atcccgggcc      1560
     cgtatctggg gatgggatat gcagggtaat taccagtctg attatgttga ctggatgctt      1620
     tcttataacc ggacggaaag tatggatgcc agcagcaggg aatggctggg ctccggcaat      1680
     cctgacacac ttatcagtga catcagcata cctgttggtc atagaggcgt ttatgccgga      1740
     tggcgtgctg aactttcagc atcagccacg catgtgaaaa aaggcgatcc ccatcaggct      1800
     ggttatacca tacattcctt ttcactgtct tataagcctg taagtgttaa aggctttgag      1860
     gcgtcagtaa ctctggataa tgccttcaac aagcttgcca tgaatggcaa aggtgtgccg      1920
     ctttcaggca gaactgtcag tctttatacc cgttatcagt ggtaa                      1965
//

If you have problems or comments...

PBIL Back to PBIL home page