(data stored in ACNUC7421 zone)

EMBL: CP000247.PE309

CP000247.PE309       Location/Qualifiers
FT   CDS_pept        336450..337241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68349"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1E1"
FT                   /protein_id="ABG68349.1"
FT                   /translation="MMKNTGYILALCLTASGHVLAHDVWITGKQAENNVTAEIGYGHNF
FT                   PSKGTIPDRRDFFENPRLYNGKETITLKPASTDYVYKTESASKDNGYVLSTYMKPGYWS
FT                   RTSSGWKPVSREGRNDVAYCEFVTKYAKSFIPGEQQMPAQLYQSPTGHELEIIPLSDIS
FT                   RFSENVKLKVLYKTSPLAGAIMELDSVSYLTSSRHTHAVEHKHPVHKAELTFVTNEDGI
FT                   VTVPSLHIGQWLAKVQNKKSFQDKSLCDETVDVATLSFSRN"
     atgatgaaaa atacaggcta tatcttagct ctttgtctga cagcatcggg gcatgtcctg        60
     gcccatgatg tctggattac aggtaaacag gcagagaaca acgttaccgc agagattggt       120
     tatggtcata atttcccctc aaaggggaca attcctgaca gaagggattt ctttgaaaat       180
     ccccggcttt ataacgggaa agagacaata acactgaagc cagcgtccac ggattatgtc       240
     tataaaactg agtctgcaag caaagataat ggttacgttc tgtcaacgta tatgaaaccg       300
     ggatactggt cgagaacctc gtcaggatgg aaaccggtca gccgggaggg cagaaatgat       360
     gtggcttact gtgaatttgt cactaaatat gcaaaatctt ttattcctgg tgaacagcag       420
     atgccagcac aactctatca gtctccaaca gggcatgagc ttgaaatcat tccgttatcc       480
     gatataagtc gtttcagtga aaatgtgaag ctgaaagttc tgtataaaac gtccccgctc       540
     gccggagcta tcatggagct tgactcggtc agttatctga catcatcccg tcatactcat       600
     gcagttgagc acaaacatcc tgttcataaa gcagaactca cctttgtaac taatgaggat       660
     ggtatcgtca cagtaccttc tcttcatatc ggacagtggc tggcgaaagt ccaaaataag       720
     aaaagttttc aggacaaaag cctgtgtgat gaaactgtcg atgtggcaac cttaagcttc       780
     tcccgaaatt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page