(data stored in ACNUC7421 zone)

EMBL: CP000247.PE327

CP000247.PE327       Location/Qualifiers
FT   CDS_pept        356041..356859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68367"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1G0"
FT                   /protein_id="ABG68367.1"
FT                   /translation="MRLASRFGYANQVRRDRPLTHEELMRHVPSIFGEDRHTSRSEHYA
FT                   YIPTITVLENLQQEGFQPFFACQTRVRDPGRRGYTKHMLRLRRNGEINGQHVPEIILLN
FT                   SHDGTSSYQMLPGYFRFVCQNGCVCGQSLGEVHVPHRGNVVDRVIEGAHEVVGVFDRIE
FT                   EKRDAMQSLVLPPPARQALAQAALTYRYGDEHQPVTTADILTPRRREDYGKDLWSAYQT
FT                   IQENMLKGGISGRSAKGKRIHTRAIHSIDTDIKLNRALWVMAETLLESMR"
     atgcgattag ccagtcgttt tggttatgcg aaccaggtac gtcgtgatcg tccgctgaca        60
     cacgaagaac tgatgcgcca tgtaccgagt atttttgggg aagaccgaca tacctcccgc       120
     agtgaacact atgcgtacat tcccactatc accgtcctgg aaaatctgca gcaggaaggc       180
     tttcagccat tcttcgcctg ccagacccgc gtacgtgacc cgggccgccg gggatacaca       240
     aaacacatgc tgcgcctgcg ccgtaacggg gagataaacg gacaacatgt ccctgaaatt       300
     attctgctca actcccatga cggtacctcc agctaccaga tgctgccggg ttacttcaga       360
     ttcgtctgcc agaacggctg cgtctgcggt cagtctctgg gggaagtcca tgtgccccac       420
     cggggaaatg tggtggacag agtcattgaa ggggctcacg aggtagtggg cgtttttgac       480
     cggattgagg aaaagcgtga tgccatgcag tctctggttc tgccgccacc ggcacgtcag       540
     gcactggcac aggcggcgct gacttaccgt tatggtgatg aacatcaacc cgtcaccact       600
     gccgacattc tgacaccacg acgccgggag gattacggta aggacctgtg gagcgcatat       660
     cagaccatcc aggagaatat gctgaaaggc gggatttccg gccgtagtgc aaaaggaaaa       720
     cgtatccata cccgcgccat tcacagtatc gacaccgaca tcaagctcaa tcgcgcattg       780
     tgggtgatgg cggaaacgct gctggagagc atgcgctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page