(data stored in ACNUC7421 zone)

EMBL: CP000247.PE330

CP000247.PE330       Location/Qualifiers
FT   CDS_pept        357997..358218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0336"
FT                   /product="hypothetical protein YeeT"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68370"
FT                   /db_xref="InterPro:IPR009329"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1H4"
FT                   /protein_id="ABG68370.1"
FT                   /translation="MKIITRGEAMRIHRQHPASRLFPFCTGKYRWHGSTEAYTGREVQD
FT                   IPGVLAVFAERRKDSFGPYVRLMSVTLN"
     atgaaaatca tcacccgtgg tgaagccatg cgtattcacc gtcagcatcc ggcatcccgt        60
     cttttcccgt tctgtaccgg caaataccgc tggcacggca gcactgaagc gtataccggt       120
     cgtgaagtgc aggatattcc cggtgtgctg gccgtgtttg ctgaacgtcg taaggacagt       180
     tttggcccgt atgtccggct gatgagcgtc accctgaact ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page