(data stored in ACNUC7421 zone)

EMBL: CP000247.PE332

CP000247.PE332       Location/Qualifiers
FT   CDS_pept        358839..359216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0338"
FT                   /product="hypothetical protein YeeV"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68372"
FT                   /db_xref="InterPro:IPR009610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1I2"
FT                   /protein_id="ABG68372.1"
FT                   /translation="MKTLPDTHVREASRCLSPVEIWQTLLTRLLDQHYGLTLNDTPFAD
FT                   ERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGFSPCTRSQLINSIDILRARRATGLM
FT                   TRDNYRTVNNITRGKHPEAKQ"
     atgaaaacat tacccgacac acacgtacgg gaggcatcgc gctgcctgtc tccggttgaa        60
     atctggcaga cactgctcac ccggttactg gaccagcact acggcctcac actgaatgac       120
     acaccgttcg ctgatgaacg tgtgattgag cagcatattg aagcagggat ttcactgtgt       180
     gacgcggtga actttctcgt tgaaaaatac gccctggtgc gtaccgacca gccgggattc       240
     agcccctgta cccgctctca gttaatcaac agtatcgata tcctccgggc acgccgggca       300
     accggcctga tgacccgcga taactacaga acggtaaata acattacccg gggtaagcat       360
     ccggaggcga aacaatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page