(data stored in ACNUC7421 zone)

EMBL: CP000247.PE333

CP000247.PE333       Location/Qualifiers
FT   CDS_pept        359213..359701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1J5"
FT                   /protein_id="ABG68373.1"
FT                   /translation="MKLALTPEADSINVQALNMGRIVVDVDGVTLAELINVVCDNGHSL
FT                   RIVDESDRASTDCMPPFAALTGIRCSTAHITETDNAWLYSLSHQTNDDGESEWIHFTGS
FT                   GYLLRTDTWPYPVLRLKRLGLSRTFRRLVVTLIRRYGVSLIHLDASARCLPGLPTFNW"
     atgaaactgg ccctgacgcc ggaagccgat agcattaacg tgcaggcact gaacatgggg        60
     cgcattgtcg ttgacgtcga tggtgttact ctcgctgaac tgattaacgt ggtctgtgat       120
     aatggccact cccttcgtat tgttgatgaa tctgaccggg cctcaacaga ctgcatgcca       180
     ccatttgctg cccttaccgg tatacgctgc agtaccgcac atatcacgga aacggacaac       240
     gcctggctgt actcgctgtc acaccagact aatgacgacg gcgaatcaga atggattcat       300
     tttaccggca gcggctatct gttacgtact gatacgtggc cgtatccggt tctgcggctt       360
     aaacgactgg gcctgtccag aacgttccgc cgtctggttg tcactctcat ccgccgttat       420
     ggcgtcagtc tcattcatct ggatgccagt gccagatgcc tgccgggttt acccactttc       480
     aactggtaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page