(data stored in ACNUC7421 zone)

EMBL: CP000247.PE339

CP000247.PE339       Location/Qualifiers
FT   CDS_pept        complement(364050..368180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0345"
FT                   /product="SepA"
FT                   /note="extracellular serine protease of the IgA1 protease
FT                   family, secreted by a C-terminal autotransporter domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68379"
FT                   /db_xref="GOA:A0A454A1H0"
FT                   /db_xref="InterPro:IPR000710"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030396"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1H0"
FT                   /protein_id="ABG68379.1"
FT                   /translation="MNKIYALKYCYITNTVKVVSELARRVCKGSTRRGKRLSVLTSLAL
FT                   SALLPTVAGASTVGGNNPYQTYRDFAENKGQFQAGATNIPIFNNKGELVGHLDKAPMVD
FT                   FSSVNVSSNPGVATLINPQYIASVKHNKGYQSVSFGDGQNSYHIVDRNEHSSSDLHTPR
FT                   LDKLVTEVAPATVTSSSTADILTPSKYSAFYRAGSGSQYIQDSQGKRHWVTGGYGYLTG
FT                   GILPTSFFYHGSDGIQLYMGGNIHDHSILPSFGEAGDSGSPLFGWNTAKGQWELVGVYS
FT                   GVGGGTNLIYSLIPQSFLSQIYSEDNDAPVFFNASSGAPLQWKFDSSTGTGSLKQGSDE
FT                   YAMHGQKGSDLNAGKNLTFLGHNGQIDLENSVTQGAGSLTFTDDYTVTTSNGSTWTGAG
FT                   IIVDKDASVNWQVNGVKGDNLHKIGEGTLVVQGTGVNEGGLKVGDGTVVLNQQADSSGH
FT                   VQAFSSVNIASGRPTVVLADNQQVNPDNISWGYRGGVLDVNGNDLTFHKLNAADYGATL
FT                   GNSSDKTANITLDYQTHPADVKVNEWSSSNRGTVGSLYIYNNPYTHTVDYFILKTSSYG
FT                   WFPTGQVSNEHWEYVGHDQNSAQALLANRINNKGYLYHGKLLGNINFSNKATPGTTGAL
FT                   VMDGSANMSGTFTQENGRLTIQGHPVIHASTSQSIANTVSSLGDNSVLTQPTSFTQDDW
FT                   ENRTFSFGSLVLKDTDFGLGRNATLNTTIQADNSSVTLGDSRVFIDKKDGQGTAFTLEE
FT                   GTSVATKDADKSVFNGTVNLDNQSVLNINDIFNGGIQANNSTVNISSDSAILGNSTLTS
FT                   TALNLNKGANALASQSFVSDGPVNISDATLSLNSRPDEVSHTLLPVYDYAGSWNLKGDD
FT                   ARLNVGPYSMLSGNINVQDKGTVTLGGEGELSPDLTLQNQMLYSLFNGYRNTWSGSLNA
FT                   PDATVSMTDTQWSMNGNSTAGNMKLNRTIVGFNGGTSSFTTLTTDNLDAVQSAFVMRTD
FT                   LNKADKLVINKSATGHDNSIWVNFLKKPSDKDTLDIPLVSAPEATADNLFRASTRVVGF
FT                   SDVTPTLSVRKEDGKKEWVLDGYQVARNDGQGKAAATFMHISYNNFITEVNNLNKRMGD
FT                   LRDINGEAGTWVRLLNGSGSADGGFTDHYTLLQMGADRKHELGSMDLFTGVMATYTDTD
FT                   ASAGLYSGKTKSWGGGFYASGLFRSGAYFDLIAKYIHNENKYDLNFAGAGKQNFRSHSL
FT                   YAGAEVGYRYHLTDTTFVEPQAELVWGRLQGQTFNWNDSGMDVSMRRNSVNPLVGRTGV
FT                   VSGKTFSGKDWSLTARAGLHYEFDLTDSADVHLKDAAGEHQINGRKDGRMLYGVGLNAR
FT                   FGDNTRLGLEVERSAFGKYNTDDAINANIRYSF"
     atgaataaaa tatacgctct aaaatattgt tatattacta acacagtaaa ggttgtctct        60
     gaactagccc gaagggtatg taaagggagt acccgcagag gaaaaagact ttcagtactt       120
     acctctctgg cactatctgc attactccca accgttgctg gtgcatcaac ggttggtggc       180
     aacaatcctt accagacata ccgcgacttt gcagaaaaca aagggcagtt tcaggctggc       240
     gcaacaaaca ttcctatttt taataataaa ggggaattag taggacatct tgataaagcg       300
     cccatggttg attttagcag tgtgaatgta agctcaaatc ccggcgttgc aacattaatt       360
     aacccgcaat atatagccag tgtaaaacat aataaaggat atcagagcgt cagcttcggt       420
     gatggtcaga acagttacca tattgtggat cgtaatgaac acagttcatc tgatctccac       480
     acaccaagac ttgataagct cgtaactgag gttgctccgg ctaccgtaac cagctcatca       540
     acagctgata tattgacccc ttcaaaatac tcggcattct acagggctgg ttcgggaagt       600
     cagtatattc aggatagtca gggtaagcga cattgggtaa caggtgggta tggttatctg       660
     acaggaggaa tactcccgac atcattcttt tatcacggct cagacggcat tcagctgtat       720
     atggggggca acatacatga tcatagcatc ctgccctctt ttggagaggc cggcgacagt       780
     ggttctccat tatttggctg gaatacggcc aaagggcagt gggaactggt cggtgtttac       840
     tcgggagtag gaggggggac caatttgata tattctctta ttcctcagag ttttctctca       900
     cagatctatt cagaggataa tgacgctccc gtctttttta atgcctcatc cggcgccccc       960
     ctgcaatgga aatttgacag cagcaccggc actggctctc tgaaacaggg ttccgatgaa      1020
     tatgccatgc acgggcaaaa aggttctgac ctgaacgcag gtaaaaatct gacattcctg      1080
     ggacataatg gtcagattga cctggaaaac tctgtcacgc agggtgccgg ttcactgaca      1140
     tttactgatg actacactgt caccacttca aacggaagta cctggaccgg ggccggtatt      1200
     attgtggaca aggatgcctc cgtaaactgg caggttaatg gtgtgaaagg tgacaacctg      1260
     cataaaatcg gcgaaggaac cctggttgta cagggaaccg gtgttaatga gggcggcctg      1320
     aaagtcgggg atgggaccgt tgtcctcaat cagcaggctg acagttcagg acacgttcag      1380
     gcattcagta gcgtgaatat tgccagcggc cgcccgacag tcgtgctggc agacaaccag      1440
     caggttaatc cggacaatat atcctggggc taccgggggg gtgttctgga tgttaacggg      1500
     aatgacctga catttcataa gctgaatgcc gccgattatg gcgcaactct cggtaacagc      1560
     agtgataaaa cggctaatat cactctggat tatcagacgc atccggcaga cgtaaaagtt      1620
     aatgaatggt catcatcaaa caggggaaca gtaggttcat tatatattta taataatccc      1680
     tatactcata ccgtcgatta ttttatcctg aaaacaagta gttatggctg gttccctacc      1740
     ggtcaggtca gtaacgagca ctgggaatat gtcggacatg accagaacag tgcacaggcg      1800
     ctgcttgcaa acagaattaa taataaaggg tatctgtatc atggcaagtt gctgggaaat      1860
     attaatttct caaataaagc aaccccgggt acaaccggcg cattggttat ggacggctca      1920
     gcgaatatgt ccggtacatt tactcaggaa aacggtcgtc tgaccattca gggccacccg      1980
     gttatccatg cttcaacgtc tcagagtatt gcaaatacag tctcgtctct gggcgacaat      2040
     tccgttctga cacagcccac ctcatttaca caggatgact gggagaacag gacgttcagc      2100
     tttggttcgc tcgtgttaaa agatacagac tttggtctgg gccgcaatgc cacactgaac      2160
     acaaccatcc aggcagataa ctccagcgtc acgctgggcg acagtcgggt atttatcgac      2220
     aaaaaagatg gccagggaac agcctttacc cttgaagaag gcacatctgt tgcaactaaa      2280
     gatgcagata aaagtgtctt caacggcacc gtcaacctgg ataatcagtc agtgctgaat      2340
     atcaatgata tattcaatgg cggaatacag gcgaacaaca gtaccgtgaa tatctcctca      2400
     gacagtgcca ttctggggaa ctcaacgctg accagtaccg ccctgaatct gaacaaggga      2460
     gcaaatgctc tggccagtca gagttttgtt tctgacggtc cagtgaatat ttctgatgcc      2520
     accctgagtc tgaacagccg tcctgatgag gtatctcaca cacttttacc tgtatacgat      2580
     tatgccggtt catggaacct gaagggagac gatgcccgcc tgaacgtggg gccgtacagt      2640
     atgttgtcag gtaatatcaa tgttcaggat aaagggactg tcaccctcgg aggggaaggg      2700
     gaactgagtc ctgacctgac tcttcagaat cagatgttgt acagcctgtt taacgggtac      2760
     cgcaatacct ggagcgggag cctgaatgca ccggatgcca ccgtcagcat gacagacacc      2820
     cagtggtcga tgaacggaaa ctccacggca ggaaatatga aacttaaccg gacaatagtc      2880
     ggttttaacg ggggaacatc atcgttcacg acactgacaa cagataatct ggacgcggtt      2940
     cagtcagcat ttgtcatgcg tacagacctt aacaaggcag acaaactggt gataaacaag      3000
     tcggcaacag gtcatgacaa cagcatctgg gttaacttcc tgaaaaaacc ctctgacaag      3060
     gacacgcttg atattccact ggtcagcgca cctgaagcga cagctgataa tctgttcagg      3120
     gcatcaacac gggttgtggg attcagtgat gtcaccccca cccttagtgt cagaaaagag      3180
     gacgggaaaa aagagtgggt cctcgatggt taccaggttg cacgtaacga cggccagggt      3240
     aaggctgccg ccacattcat gcacatcagc tataacaact tcatcactga agttaacaac      3300
     ctgaacaaac gcatgggcga tttgagggat attaacggcg aagccggtac gtgggtgcgt      3360
     ctgctgaacg gttccggctc tgctgatggc ggtttcactg accactatac cctgctgcag      3420
     atgggggctg accgtaagca cgaactggga agtatggacc tgtttaccgg cgtgatggcc      3480
     acctacactg acacagatgc gtcagcaggc ctgtacagcg gtaaaacaaa atcatggggt      3540
     ggtggtttct atgccagtgg tctgttccgg tccggcgctt actttgattt gattgccaaa      3600
     tatattcaca atgaaaacaa atatgacctg aactttgccg gagctggtaa acagaacttc      3660
     cgcagccatt cactgtatgc aggtgcagaa gtcggatacc gttatcatct gacagatacg      3720
     acgtttgttg aacctcaggc ggaactggtc tggggaagac tgcagggcca aacatttaac      3780
     tggaacgaca gtggaatgga tgtctcaatg cgtcgtaaca gcgttaatcc tctggtaggc      3840
     agaaccggcg ttgtttccgg taaaaccttc agtggtaagg actggagtct gacagcccgt      3900
     gccggcctac attatgagtt cgatctgacg gacagtgctg acgttcacct gaaggatgca      3960
     gcgggagaac atcagattaa tgggagaaaa gacggtcgta tgctttacgg tgtggggtta      4020
     aatgcccggt ttggcgacaa tacgcgtctg gggctggaag ttgaacgctc tgcattcggt      4080
     aaatacaaca cagatgatgc gataaacgct aacattcgtt attcattctg a               4131
//

If you have problems or comments...

PBIL Back to PBIL home page