(data stored in ACNUC7421 zone)

EMBL: CP000247.PE341

CP000247.PE341       Location/Qualifiers
FT   CDS_pept        368773..368988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0347"
FT                   /product="insertion element IS1 1/2/3/5/6 protein InsA"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68381"
FT                   /db_xref="GOA:A0A454A1J8"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1J8"
FT                   /protein_id="ABG68381.1"
FT                   /translation="MATVTVHRPRCNSDKVYRHGRSCSQHERFRCRSCKRVFQLTYSYE
FT                   ARKPGFKELIVEMAHNGTGAVISPEH"
     atggctaccg ttactgttca tcgtccgcgc tgtaattccg ataaagttta tcgacatggt        60
     cgtagttgtt cccagcatga gcgtttccgt tgtcgttcat gtaaacgtgt tttccagctc       120
     acttactctt atgaagccag aaaacccggc tttaaggagc tgatcgttga aatggcgcat       180
     aatggcacag gggccgtgat atcgccagaa cactga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page