(data stored in ACNUC7421 zone)

EMBL: CP000247.PE349

CP000247.PE349       Location/Qualifiers
FT   CDS_pept        complement(376652..377368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0355"
FT                   /product="hypothetical protein YagY precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68389"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKZ2"
FT                   /protein_id="ABG68389.1"
FT                   /translation="MYQQGSPPALFLDGIVMKKHLLPLALLFSGISPAQALDVGDISSF
FT                   MNSDSSTLSKTIQNSTDSGRLINIRLERLSSPLDDGQVIAMDKPDELLLTPASLLLPAQ
FT                   ASEVIRFFYKGPADEKERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQ
FT                   ANYHFQYANGSLTNTGNATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADN
FT                   KGRVALWQGDKFIPVK"
     atgtaccagc aggggtcccc ccctgcttta ttcctggacg gaattgttat gaaaaagcac        60
     cttctgcctc tcgctctgct gttttccgga atatcaccgg cccaggcgct ggatgtcggc       120
     gatatatcat cgtttatgaa cagtgacagc agcacgctga gcaaaacgat ccaaaacagt       180
     accgacagtg gccgcctcat caatatccgt ctcgaacggc tctcttcacc gcttgacgac       240
     gggcaggtta tcgcaatgga caagccggat gagttgctac tcactcccgc cagcttgctg       300
     ctacccgccc aagccagcga agtgatccgc ttcttctata agggaccagc agatgaaaaa       360
     gagcgctact accgcattgt ctggtttgat caggccctca gtgatgcgca gcgcgataat       420
     gccaaccgta gcgctgtggc cactgcttcc gcccgcatcg gcaccattct ggtcgtcgca       480
     ccccgccagg caaactacca ctttcagtac gccaacggct ccctgacaaa tacaggaaat       540
     gcgacgctgc ggatcctcgc ctacggcccc tgcctgaaag ccgccaatgg taaggagtgt       600
     aaagagaatt actacctgat gccgggcaag tcgcgtcgtt ttacccgcgt ggacacggcg       660
     gataacaaag gacgggttgc actttggcag ggtgataagt tcattcccgt gaaatag          717
//

If you have problems or comments...

PBIL Back to PBIL home page