(data stored in ACNUC7421 zone)

EMBL: CP000247.PE350

CP000247.PE350       Location/Qualifiers
FT   CDS_pept        complement(377377..377964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0356"
FT                   /product="hypothetical protein YagZ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68390"
FT                   /db_xref="GOA:Q0TKZ1"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKZ1"
FT                   /protein_id="ABG68390.1"
FT                   /translation="MKKKVLAIALVTVFTGTGVAQAADVTAQAVATWSATAKKDTTSKL
FT                   VVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGST
FT                   LNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGT
FT                   TNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS"
     atgaaaaaaa aggttctggc aatagctctg gtaacggtgt ttaccggtac aggtgtagcg        60
     caggctgctg acgtaacagc tcaggctgta gcgacctggt cagcaacagc caaaaaagac       120
     accaccagta agctggttgt gacgccactc ggtagcctgg cgttccagta tgccgaaggc       180
     attaaaggtt ttaactcaca aaaaggtcta tttgacgtgg ctatcgaggg tgactcaacg       240
     gctaccgcct ttaaactgac ctcacgtctt atcaccaaca ccttaaccca gttggatacc       300
     tcaggttcca cactgaatgt gggcgtggat tataacggcg cggcagtcga aaaaactggc       360
     gataccgtga tgatcgatac cgccaacggc gtactgggcg gcaaccttag cccactggct       420
     aacggttaca atgccagcaa tcgtaccacc gcacaggatg gtttcacttt ctccatcatc       480
     agcggcacca ccaatggtac caccgcagta accgattaca gcactctacc ggaaggcatc       540
     tggagcggcg acgttagcgt acagttcgac gctacctgga ccagttaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page