(data stored in ACNUC7421 zone)

EMBL: CP000247.PE351

CP000247.PE351       Location/Qualifiers
FT   CDS_pept        complement(378039..378581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0357"
FT                   /product="hypothetical protein YkgK"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68391"
FT                   /db_xref="GOA:Q0TKZ0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKZ0"
FT                   /protein_id="ABG68391.1"
FT                   /translation="MECQNRSDKYIWSPHDAYFYKGLSELIVDIDRLIYLSLEKIRKDF
FT                   VFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANYWYYNSNIRGVVYAGLS
FT                   RDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPKSIARIENCSVKTVYTH
FT                   RRNAEAKLYSKLYKLVQ"
     atggaatgtc aaaaccgttc tgataaatac atctggtctc cccatgacgc ctacttctat        60
     aaaggactat ctgaactgat tgtggatatc gacagattaa tttatctatc gctggagaaa       120
     atcagaaaag atttcgtgtt tatcaatctc aatacggatt ctttaactga gtttataaac       180
     cgtgataatg agtggttatc cgcggtaaag gggaaacagg tcgtattgat tgcggccaga       240
     aagtcagaag ccttagcaaa ttattggtat tacaacagca atattagggg cgtggtatac       300
     gctggactga gtcgtgatat tagaaaagaa ctggcctatg tgattaatgg caggttcctg       360
     agaaaagata ttaagaaaga taaaatcact gaccgggaaa tggaaattat ccgcatgacg       420
     gctcagggaa tgctgcctaa atcgattgcc agaattgaaa attgtagtgt gaagacagtg       480
     tatacccatc ggcggaatgc agaggccaag ctgtactcaa aattatataa gttggttcag       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page