(data stored in ACNUC7421 zone)

EMBL: CP000247.PE354

CP000247.PE354       Location/Qualifiers
FT   CDS_pept        complement(379805..380071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0360"
FT                   /product="50S ribosomal protein L31 type B"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68394"
FT                   /db_xref="GOA:A0A454A1G3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1G3"
FT                   /protein_id="ABG68394.1"
FT                   /translation="MMKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPY
FT                   VTIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
     atgatgaaac ccaatatcca tcctgagtat cgtactgtgg tgttccacga caccagcgtt        60
     gatgagtact ttaaaatcgg ctcgactatc aaaacagacc gtgagattga gctggatggc       120
     gtaacgtatc cgtacgtaac aattgatgtc tcttcgaaat cgcacccgtt ctatacaggg       180
     aagctgagaa cagtggcatc agaaggaaat gttgcacggt tcacccaacg ttttggtcgt       240
     tttgttagca cgaaaaaggg ggcatga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page