(data stored in ACNUC7421 zone)

EMBL: CP000247.PE356

CP000247.PE356       Location/Qualifiers
FT   CDS_pept        complement(382321..383241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0362"
FT                   /product="hypothetical protein YcjY"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68396"
FT                   /db_xref="GOA:A0A454A1I1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1I1"
FT                   /protein_id="ABG68396.1"
FT                   /translation="MKTVSIKHTYWDIAADIYFPDDFNSEKKYPAIISAHPIGSCKEQT
FT                   SGSVYGAALAKAGFIVIAFDASFQGSSGGEPRYLEDPTMRVKDFSIVVDYLTTLPYVDA
FT                   GRIGVLGICGGGGYAINAAMTERRIKAIGTVTGANYGRLMREGFTAFNPIGALEAMAQQ
FT                   RTDEANGAKLRVDDLLPSSPEAALEAGLTEIDLFEATEYYRSPRGCAPNGVNRSLFSHQ
FT                   TVAVGWDAFHLAEVLLTQPLMVVVGDRVGAFGAYRDGCEIIGRAASKHKELVVVEGYSH
FT                   YDLYDKPEPVKQALDKLIPFYKTHL"
     atgaaaactg tttcgataaa acacacttac tgggatatag ctgctgatat ctatttccct        60
     gacgatttta atagtgaaaa aaagtatcct gccattatca gtgcccatcc aattggaagc       120
     tgcaaagaac agacatcggg tagtgtgtat ggtgccgccc tggcaaaagc tggctttatc       180
     gtcattgctt ttgatgccag ttttcaggga agcagcggtg gagaaccgcg ttatctggaa       240
     gatccaacaa tgcgagtaaa agacttcagc attgtcgttg attaccttac caccttacct       300
     tacgttgatg ccgggcgtat tggtgtactg ggtatttgtg gtggaggtgg atatgccatt       360
     aatgccgcaa tgacagaacg tcggattaaa gccattggta ctgtcacggg tgcaaactac       420
     gggcgtctta tgcgtgaggg atttacagcg tttaatccta tcggagcact cgaagcaatg       480
     gcgcaacaaa gaacagacga agctaacggc gcaaaacttc gcgtagatga tttgctccct       540
     tcttctccgg aagcagctct tgaagcggga ttaacagaaa tagacctttt tgaagcaaca       600
     gaatattatc gttcgccacg aggctgtgcg cctaatgggg taaatcgttc gctattttca       660
     catcagactg ttgccgtggg ctgggatgct tttcatcttg cagaagtcct gttaactcaa       720
     ccactaatgg ttgtagtggg cgatagagtg ggcgcttttg gtgcctatcg tgacggctgc       780
     gaaattattg gtcgtgcagc ctcaaaacat aaagaactgg tcgtggttga aggttattca       840
     cattacgacc tgtatgataa gccagaacct gtgaaacagg cgctcgataa attaattcct       900
     ttttacaaaa cacatttgta a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page