(data stored in ACNUC7421 zone)

EMBL: CP000247.PE372

CP000247.PE372       Location/Qualifiers
FT   CDS_pept        complement(401358..402026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0378"
FT                   /product="hypothetical protein YkgH"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68412"
FT                   /db_xref="GOA:A0A454A1L9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1L9"
FT                   /protein_id="ABG68412.1"
FT                   /translation="MNEQIKQDIDLIEILFYLKKKIRVILFIIAICMAMVLLFLYINKD
FT                   NIKVSYSLKINQTTPGILVSCDSNNNFACQTTMTEDVIQRITTFFQTSPDVKNREIKLE
FT                   WSGDKRDLPTAEAEISRVQASIIKWYTSEYHNGRQVLDEIQTPSAINSELYTKMIYLTR
FT                   NWSLYPNGDGCVTISSPEIKNKYPAAICLALGFFLSIVISVMFCLVKKMVDEYQQNSGQ
FT                   "
     atgaatgaac aaatcaaaca ggatatcgat ctgattgaga ttttatttta tctgaagaaa        60
     aagattcgtg ttatcctttt tattatagct atctgtatgg caatggtgct gttgtttctg       120
     tatatcaata aagataatat aaaagtgagt tacagcctaa aaataaatca gacaacacca       180
     ggcatacttg ttagctgtga tagcaataat aactttgcct gtcagaccac aatgactgaa       240
     gacgttattc agcgaattac tacatttttt cagaccagcc cagatgtcaa gaacagagaa       300
     ataaagctgg aatggtcagg agataagaga gatttaccaa ctgctgaagc ggaaatatct       360
     cgcgtgcagg cgtctatcat taaatggtat acgtcagaat accataatgg caggcaagtt       420
     ctcgatgaga tacaaacgcc ttcagcaatt aacagtgagc tttatacaaa aatgatatac       480
     ctgaccagga actggtcact gtatccgaac ggtgatggct gtgtcactat aagctcacca       540
     gaaataaaaa ataaataccc tgctgccatt tgcctggctc tgggattttt tctaagtatt       600
     gtgatttctg taatgttttg ccttgtcaaa aaaatggtag atgaatacca acaaaactct       660
     gggcagtaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page