(data stored in ACNUC7421 zone)

EMBL: CP000247.PE374

CP000247.PE374       Location/Qualifiers
FT   CDS_pept        complement(404549..405310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0380"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68414"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1I0"
FT                   /protein_id="ABG68414.1"
FT                   /translation="MRFVLFCPSGIVPAQFAALSTGSVGNVTCIGTEEELRNKLRHWPQ
FT                   SVVISAGRPAECAEMWFRFYRDHSFVVVLCVAPFFLPPDVSISGVLKNLRLLKPGMSVE
FT                   RVISIANTSGGFSGLKHAEILPVMDSYSVFMKEVNNRTKTIVMSERFPEKQKKVLSLLL
FT                   AGHSWEYSAQFLKTGIRQIWLAEQSLKKRWGIPDSMSLREALLLSSNNFHGDGNALETT
FT                   NAMTLRENGNTNRYSVVVNAGTQALSLHKYK"
     atgcgtttcg ttcttttctg tccctcagga attgtaccag cgcagttcgc agctctatca        60
     accggttctg tcggcaatgt tacctgcatc ggaacagaag aggagttacg caataaattg       120
     cggcactggc cacagagtgt cgtgatatcg gcagggcgac ctgccgaatg cgctgaaatg       180
     tggttccgat tttatcggga tcactcattc gtggtggtgt tgtgcgtcgc gccctttttt       240
     ctgccaccgg atgtgagtat ttctggcgtt ctcaaaaacc tgaggttact gaaaccagga       300
     atgtcagtag agcgagttat cagtattgca aatacctctg gtgggttttc agggctgaaa       360
     catgcagaaa ttttgccagt tatggacagt tactctgtct ttatgaaaga ggtgaataac       420
     cgcacaaaga caatcgtcat gtcagaacgc ttcccggaaa agcaaaagaa ggtgttgtcg       480
     ttgcttcttg ccggacacag ctgggaatac agtgcgcagt ttctcaaaac ggggataaga       540
     cagatatggc ttgccgagca gtcgctaaaa aagcgttggg gaataccgga cagcatgtca       600
     ttgcgggaag ccctgctgct gagcagcaat aattttcacg gtgatggaaa tgcattggaa       660
     acaacgaatg ccatgacatt gcgtgaaaac ggaaatacca acaggtattc cgtggtggta       720
     aatgcaggga cgcaggcttt atctctgcat aaatataaat aa                          762
//

If you have problems or comments...

PBIL Back to PBIL home page