(data stored in ACNUC7421 zone)

EMBL: CP000247.PE377

CP000247.PE377       Location/Qualifiers
FT   CDS_pept        407041..407247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1K9"
FT                   /protein_id="ABG68417.1"
FT                   /translation="MNESHHNQTAISFRKGYALGCIHQPVDFILCEIFSRHTPPCTVVK
FT                   KREAHPDKYACNQNVIDVISLSH"
     gtgaatgaaa gccatcataa tcagacagcg atttctttca ggaaaggata tgctctgggc        60
     tgcatccatc agcctgtaga cttcatcctg tgtgagatat tttctcgtca tacgccaccg       120
     tgtacagttg taaaaaaaag agaggcacac ccagataagt atgcctgcaa tcagaacgtt       180
     atcgatgtaa tctcattatc tcattaa                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page