(data stored in ACNUC7421 zone)

EMBL: CP000247.PE379

CP000247.PE379       Location/Qualifiers
FT   CDS_pept        407967..408194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1K5"
FT                   /protein_id="ABG68419.1"
FT                   /translation="MLTVSGNEQVTIARNISGVILKLSGISSVVYLCMHSTFISQIEQV
FT                   SLEFAGEIVTMKHESYLSVLYKDSVLIVER"
     atgctaaccg tgagcgggaa tgaacaggta accatagcca ggaacattag cggcgtaatt        60
     cttaagctga gtggtatttc atctgtagtt tatctgtgta tgcatagcac cttcatcagc       120
     cagattgagc aagtcagctt agaatttgct ggcgagattg tcacgatgaa gcatgagagt       180
     tacctcagtg ttttatataa ggattcggtc ctcatagtag aacggtaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page