(data stored in ACNUC7421 zone)

EMBL: CP000247.PE383

CP000247.PE383       Location/Qualifiers
FT   CDS_pept        411910..412125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1N5"
FT                   /protein_id="ABG68423.1"
FT                   /translation="MHAHFIYCFQRGVDQLSAPDRLHPQFGHFRHSIHQRCLSIKAVID
FT                   WTFNIKCVLIVTNLILNGNNNSGDTG"
     gtgcatgccc acttcattta ttgcttccag cgtggcgtcg atcagttgtc tgcgccggat        60
     cgactgcatc cccaatttgg gcattttcgc cactccattc atcagcgttg tttatctatt       120
     aaagcggtta ttgattggac gttcaatata aaatgtgtct taattgttac taatttgatt       180
     ttaaatggta acaataacag tggggatact ggatga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page