(data stored in ACNUC7421 zone)

EMBL: CP000247.PE384

CP000247.PE384       Location/Qualifiers
FT   CDS_pept        412122..414155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0390"
FT                   /product="high-affinity choline transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68424"
FT                   /db_xref="GOA:A0A454A1J2"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1J2"
FT                   /protein_id="ABG68424.1"
FT                   /translation="MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGR
FT                   TLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAG
FT                   IGIDLMFFSVAEPITQYMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGY
FT                   FSYRYNLPLTIRSALYPIFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLS
FT                   VLFDIPDSMAAKAALIALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDT
FT                   SFLLNALVLNVGDYVNRFMGMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLAR
FT                   ISRGRTIRQFVLGTLIIPFTFTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSL
FT                   LAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAI
FT                   GLLTLGMLMTNGISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPR
FT                   PLGLQDRLSWKKRLSRLMNYPGTRYTKQMMETVCYPAMEEVAQELRLRGAYVELKNLPP
FT                   EEGQQLGHLDLLVHMGEEQNFVYQIWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQG
FT                   NDLMDYSKEQVITDILDQYERHLNFIHLHREAPGHSVMFPDA"
     atgacagacc tttcacacag cagggaaaag gacaaaatca atccggtggt gttttacact        60
     tccgccggac tgattttgtt gttttccctg acaacgattc tgtttcgcga cttctcggcc       120
     ctgtggattg gccgcacgct ggactgggtc tctaaaacct tcggttggta ctatctgctg       180
     gcggcaacgc tctatattgt ctttgtggtc tgtatcgctt gttcgcgttt tggttcggtg       240
     aagctcgggc cagaacaatc aaaaccggaa ttcagtctgc tgagttgggc ggcgatgctg       300
     tttgctgccg ggatcggtat cgacctgatg ttcttctccg tagccgaacc gataacgcag       360
     tatatgcagc cgccggaagg cgcgggacag acgattgagg ccgcgcgtca ggcgatggtc       420
     tggacgctgt ttcactacgg cttaaccggc tggtcgatgt atgcgctgat gggcatggcg       480
     ctcggatact ttagctatcg ttataatttg ccgctcacta tccgctcggc gctgtacccg       540
     atcttcggta aacggattaa cgggccgata ggtcactcag tggatattgc tgcggtgatc       600
     ggcaccatct tcggtattgc cactacgctc ggtatcggtg tggtacagct taactatggc       660
     ttgagcgtgc tgtttgatat tcccgattcg atggcggcga aagcggcact gatcgccttg       720
     tcggtgatca tcgccactat ctcggtgaca tccggtgttg ataagggcat tcgcgtgtta       780
     tcggaactca acgttgcgct ggcgctggga ttgatcctgt tcgtgttgtt tatgggcgac       840
     acctcgttcc tgcttaatgc actggtgctg aatgttggcg actatgtgaa tcgctttatg       900
     ggcatgacac tcaacagttt tgccttcgac cgtccggttg agtggatgaa taactggacg       960
     ctcttcttct gggcatggtg ggtggcatgg tcgccgtttg tcggcttgtt cctggcgcgt      1020
     atctcgcgtg ggcgtaccat tcgccagttc gtgctgggca cgttgattat tccgtttacc      1080
     ttcacgctgt tatggctctc ggtattcggc aatagcgcgc tgtatgaaat catccacggc      1140
     ggcgcggcat ttgccgagga agcgatggtc catccggagc gcggcttcta cagcctgctg      1200
     gcgcagtatc cggcgtttac ctttagcgcc tccgtcgcca ccattactgg cctgctattt      1260
     tatgtgacct cggcggactc cggtgcgctg gtgctgggga atttcacctc gcagcttaaa      1320
     gatatcaaca gcgacgcccc cggctggctg cgtgtcttct ggtcggtggc gattggcctg      1380
     ctgacgctag gcatgctgat gaccaacggg atatccgcgc tgcaaaacac cacggtgatt      1440
     atgggcctgc cgttcagctt tgtgatcttc ttcgtgatgg cggggttgta taaatctctg      1500
     aaggtagaag attaccgccg tgaaagtgcc aaccgcgata ccgcaccgcg accgctgggg      1560
     cttcaggatc gcctgagctg gaaaaaacgt ctctcgcgcc tgatgaatta tccgggcacg      1620
     cgttacacta aacagatgat ggagacggtc tgttatccgg caatggaaga agtggcgcag      1680
     gaactgcggt tgcgcggcgc gtacgtggag ctaaaaaacc tgccgccgga agagggacaa      1740
     cagttggggc atctggattt gttggtgcat atgggcgaag agcagaactt tgtctatcag      1800
     atttggccgc agcaatattc agtgccgggc tttacctacc gcgcacgtag cgggaaatcg      1860
     acctactacc gactggaaac cttcctgtta gaaggcagcc agggcaacga cctgatggac      1920
     tacagcaaag agcaggtgat caccgatatt ctcgaccagt acgagcggca ccttaacttt      1980
     atccatctcc atcgtgaagc gccgggccat agcgtgatgt tcccggacgc gtga            2034
//

If you have problems or comments...

PBIL Back to PBIL home page