(data stored in ACNUC7421 zone)

EMBL: CP000247.PE387

CP000247.PE387       Location/Qualifiers
FT   CDS_pept        complement(417185..417682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0393"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68427"
FT                   /db_xref="GOA:A0A454A1M2"
FT                   /db_xref="InterPro:IPR009476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1M2"
FT                   /protein_id="ABG68427.1"
FT                   /translation="MNGLTATGVTVGICAGLWQLVSSHVGLSQGWELLGTIGFVAFCSF
FT                   YAAGGGKSGFIKSLAVNYSGMVWAFFAALAAGWLAPVSGLSAFWASVITTVPFSAVVVW
FT                   QGRFWLLSFIPGGFLGMTLFFASGMNWTVTLLGFLAGNCVGIISEYGGQKLSEATTKSD
FT                   GY"
     atgaacggac tcacggcaac gggtgtcacc gtcggtattt gtgcagggct ttggcagtta        60
     gtgtcttcac atgtcgggct ctctcaggga tgggaattat taggaaccat tggcttcgtc       120
     gccttttgca gtttttatgc cgcaggcggc ggtaaatcgg ggtttatcaa aagcctggcg       180
     gttaattatt ccgggatggt gtgggcgttt ttcgccgcgc tggctgccgg ttggctggcc       240
     ccggtgagtg gactgtccgc gttctgggcg agcgtgatta cgactgtacc cttctcggcg       300
     gtggtggtct ggcaagggcg tttctggtta ctgtctttta ttcccggagg ctttctcggc       360
     atgacgctat tttttgccag cgggatgaac tggacggtga cattactggg ttttctggcg       420
     ggtaactgcg tggggataat ttcagaatac ggcggacaaa aattaagcga agcgacgacc       480
     aaaagcgacg ggtattaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page