(data stored in ACNUC7421 zone)

EMBL: CP000247.PE389

CP000247.PE389       Location/Qualifiers
FT   CDS_pept        417940..418545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0395"
FT                   /product="ankyrin-repeats protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68429"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1L0"
FT                   /protein_id="ABG68429.1"
FT                   /translation="MTIKNLPADYLLAAQQGDIDKVKNCLALGVDINTCDRHGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNDDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLANTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
     atgactataa aaaatctacc tgccgactat ttattggctg cacaacaggg cgatatcgat        60
     aaagtaaaaa actgccttgc gctgggtgtc gatattaata cctgcgatcg ccacgggaaa       120
     acggcaatta cgctggcaag tttatatcag caatatgctt gcgttcaggc attaattgac       180
     gccggagcgg atattaataa acaagatcat acctgtttaa atcctttttt aattagctgt       240
     ctgaacgatg atttaacgct actacgaatt attttaccgg ctaaacccga tcttaattgc       300
     gtaacccgtt ttggcggtgt cggcctgacg cctgcctgtg aaaaaggcca tttaagtatt       360
     gtaaaagagc ttttggcaaa tacggagatt aacgttaacc agactaacca tgttggctgg       420
     acaccgttgc tggaagcgat tgtgcttaac gatggcggga ttaaacagca ggcgattgtc       480
     cagttattgc tggaacacgg tgccagcccg catctgaccg ataaatatgg caaaacgccg       540
     ctggaactgg cgcgggaacg gggctttgaa gagattgcgc agttgctgat cgccgcaggt       600
     gcataa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page