(data stored in ACNUC7421 zone)

EMBL: CP000247.PE390

CP000247.PE390       Location/Qualifiers
FT   CDS_pept        418585..419448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0396"
FT                   /product="hypothetical protein YahE"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68430"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1M9"
FT                   /protein_id="ABG68430.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFNGLFRHGDKVQFDDQGITVGQHLHIEMSHCQRWLSPTLQMTALNF
FT                   HLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVNDKQNIASA
FT                   VASMMGLGIGLTPSADDYLTGLVLILFISGHPAEKYKEEFYRGLQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     gtgtgggcgc taactgcgga tgctgatttt ctggcgcagc gggggcaagg acaggttgaa        60
     caggtctttg ccagagcggt aaatatcgca ctcccggctc gccagcagtt gctgacgctg       120
     ctttgtgaag agtacgacaa tgcgccaaac agttgtcggt tggcactcac tcactttaat       180
     ggtctgttcc ggcatggtga taaggttcag tttgacgatc aaggcattac ggttggtcaa       240
     catcttcata tagagatgag tcattgccag cgttggctgt ccccaacctt gcaaatgacc       300
     gctctgaatt ttcaccttat cgcctggcaa cagtggcacg acattattca tcagcacctg       360
     ggggaaaatg aaaccctgtt taattatcgc ggcgataatc cgttttatca ggcgttaaat       420
     aaagaactac atattaaacg acgggcagtt attcaggccg taaacgataa acaaaatatc       480
     gcctcagcag tcgccagtat gatgggctta gggattggcc ttacgccatc agccgatgat       540
     tatctgaccg gactggtact tattttattt atttccgggc atccggcaga aaaatacaaa       600
     gaggaatttt atcgcggtct gcaacgcggc agaaataata ccacgttatt aagtgccatc       660
     acgctggaag ccgcattaca acaacgctgc cgggaaaata ttcatcgttt tattcacaac       720
     attatttatg acatccctgg gaacgcaact caggcaatag aaaaaattaa acatattggc       780
     tccagttccg gctgcgacat gctgtatggc atggccgatg gttgtgcgct gagccaaact       840
     tacggaggga attatgtcag ttaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page