(data stored in ACNUC7421 zone)

EMBL: CP000247.PE412

CP000247.PE412       Location/Qualifiers
FT   CDS_pept        446829..447368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68452"
FT                   /db_xref="InterPro:IPR018636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1Q3"
FT                   /protein_id="ABG68452.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQTQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
     atggcaaaac ttaccttaca agagcagttg ctcaaagcgg gactagtcac cagcaaaaaa        60
     gcggcgaagg tcgagagaac ggcaaaaaaa tcgcgtgttc aggcgcgtga agctcgggcg       120
     gcggtagaag aaaataaaaa ggcacagctt gagcgtgata aacagcttag cgagcaacaa       180
     aaacaagcgg cgttggcgaa agaatataaa gcccaggtga agcagctcat tgaaatgaac       240
     cgaattacca ttgccaatgg cgatattggt tttaacttca ctgacggcaa tctgattaag       300
     aagatttttg ttgataagct cacgcaaacg cagttgatta atggtcgtct ggcgattgcc       360
     cgcttgttgg ttgataacaa tagcgaaggt gaatacgcca ttattcccgc cagcgttgcc       420
     gataaaattg ctcagcgtga tgccagcagt attgtgttgc acagcgcgct cagcgccgaa       480
     gagcaggatg aagacgatcc gtatgccgac ttcaaagtgc ctgatgattt gatgtggtaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page