(data stored in ACNUC7421 zone)

EMBL: CP000247.PE415

CP000247.PE415       Location/Qualifiers
FT   CDS_pept        complement(449665..449940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0422"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68455"
FT                   /db_xref="GOA:Q0TKS6"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKS6"
FT                   /protein_id="ABG68455.1"
FT                   /translation="MPSTPEEKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAV
FT                   RGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK"
     atgcccagta ctccggaaga gaagaaaaag gtccttactc gagttcgtcg tattcggggg        60
     cagattgatg ctctggaacg gtcgctggag ggtgatgccg aatgccgtgc catactccaa       120
     cagatcgctg ccgttcgggg tgcggctaac ggactgatgg cagaagtgct tgaaagccat       180
     atccgggaaa cgtttgaccg aaatgactgc tacagccgcg aagtcagcca atccgttgac       240
     gacactattg aactggttcg tgcctatctt aaatag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page