(data stored in ACNUC7421 zone)

EMBL: CP000247.PE422

CP000247.PE422       Location/Qualifiers
FT   CDS_pept        454925..455692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0429"
FT                   /product="taurine transport ATP-binding protein TauB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68460"
FT                   /db_xref="GOA:Q0TKS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0TKS1"
FT                   /protein_id="ABG68460.1"
FT                   /translation="MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKGIQGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGVEKMQ
FT                   RLEIAHQMVKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
     atgctgcaaa tttctcatct ttacgccgat tatggcggca aaccggcact ggaagatatc        60
     aacctgacgc tggaaagcgg cgagcttctg gtagttctgg gcccgtctgg ctgcggcaaa       120
     actacgttgc tgaatttgat tgctggtttt gtgccttatc agcatggcag cattcaactg       180
     gcgggtaagg gtattcaggg accgggagca gagcgtggcg tagtttttca gaatgaaggg       240
     ctgttaccgt ggcgcaatgt acaggacaac gtggcgttcg gcctgcaact ggcaggtgta       300
     gagaaaatgc agcgactgga aatcgcacac cagatggtga aaaaagtcgg gctggaaggc       360
     gcagaaaaac gctacatctg gcagctttcc ggtggtcaac gtcagcgggt ggggattgcc       420
     cgcgcgttgg cggcaaatcc ccagctgtta ttactcgacg aaccgtttgg tgcgctggac       480
     gccttcaccc gcgaccagat gcaaaccctg ctgctgaaac tctggcagga gacgggaaag       540
     caggtgctgt tgattaccca cgatatagaa gaagcggtgt ttatggcgac tgaactggtt       600
     ctgctttcac ccggcccagg ccgtgtgctg gagcggctgc cgctcaactt tgctcgccgc       660
     tttgttgcgg gagagtcgag ccgcagcatc aagtccgatc cacaattcat cgccatgcgc       720
     gaatatgttt taagccgcgt atttgagcaa cgggaggcgt tctcatga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page