(data stored in ACNUC7421 zone)

EMBL: CP000247.PE423

CP000247.PE423       Location/Qualifiers
FT   CDS_pept        455689..456516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0430"
FT                   /product="taurine transport system permease protein TauC"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68461"
FT                   /db_xref="GOA:A0A454A1R3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1R3"
FT                   /protein_id="ABG68461.1"
FT                   /translation="MSVLINEKLHSHRLKWRWPLSRQVTLSIGTLAVLLTVWWAVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRILLALLAAVLIGIPVGIA
FT                   MGLSPTVRGILDPIIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
     atgagtgtgc tcattaatga aaaactgcat tcgcatcggc tgaaatggcg ctggccgctc        60
     tcgcgtcagg tgaccttaag cattggtacg ttagcggttt tgctcactgt atggtgggca       120
     gtcgcggcgc tgcaactgat tagcccgctg tttttgccgc caccgcaaca ggtactggca       180
     aaactgctca ccattgccgg gccgcaggga tttatggacg ccacgctgtg gcagcatctg       240
     gcagccagcc tgacgcgcat tttgctggcg ctactcgcgg cggtgttgat cggtattccg       300
     gtcgggatcg ccatggggct aagcccgacg gtgcgcggca ttctggatcc gataatcgag       360
     ctttatcgtc cggtgccgcc gctggcttat ttgccgctga tggtgatctg gtttggtatt       420
     ggcgaaacct cgaagatctt actgatctat ctagcgattt ttgcgccggt ggcgatgtcg       480
     gcgctggcgg gggtgaaaag cgcgcagcag gttcgcattc gtgccgccca gtcgctgggt       540
     gccagccgtg cgcaggtgct gtggtttgtc attttgcccg gcgcgctgcc ggaaatcctc       600
     accggattac gcattggtct gggtgtgggc tggtctacgc tggtggcggc ggagctgatt       660
     gccgcaacgc gcggtttagg atttatggtt cagtcagcgg gtgaatttct cgcgactgac       720
     gtggtgctgg cggggatcgc ggtgattgcg attatcgcct ttcttttaga actgggtctg       780
     cgcgcgttac agcgccgcct gacgccctgg catggagaag tacaatga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page