(data stored in ACNUC7421 zone)

EMBL: CP000247.PE429

CP000247.PE429       Location/Qualifiers
FT   CDS_pept        464110..465330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0436"
FT                   /product="putative ABC superfamily transporter (SbmA
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68467"
FT                   /db_xref="GOA:A0A454A1Q7"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1Q7"
FT                   /protein_id="ABG68467.1"
FT                   /translation="MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFAFFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIVGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
     atgtttaagt cttttttccc aaagccggga acgttttttc tctcggcctt tgtttgggca        60
     ttgattgccg ttatcttctg gcaagccggt gggggtgatt gggtggcgcg tatcaccggc       120
     gcttccgggc agatcccgat tagcgccgcg cgtttctggt cgttggattt cctgattttt       180
     tacgcttact acattgtttg cgtaggactt tttgcatttt tctggtttat ctatagcccg       240
     caccgttggc aatactggtc aatactcggt actgcgctga ttatcttcgt cacctggttt       300
     ttggtggaag tcggggttgc cgtcaacgcc tggtatgcgc cgttctatga tctgattcaa       360
     acggcgctaa gttcgccgca taaagtcacc atcgaacaat tttaccgcga agtgggcgtc       420
     tttctgggga ttgcgctgat cgcggtggtg atcagtgtgc tgaacaactt ctttgtcagt       480
     cactacgtgt tccgctggcg tacggcgatg aacgaatatt acatggcgaa ctggcaacaa       540
     ctgcgtcata tcgaaggggc cgcgcagcgt gtgcaggaag acaccatgcg ttttgcttca       600
     acgctggaga atatgggcgt cagctttatc aacgctatca tgacgttgat cgccttcctg       660
     ccggtgctgg taacgctctc cgcacatgtg ccggagctgc cgattgtcgg gcacattccg       720
     tatggtctgg tgattgccgc tatcgtctgg tcgctgatgg ggaccggatt actggcagtg       780
     gtagggatca aactgccggg gctggagttt aaaaaccagc gtgtagaggc tgcctaccgt       840
     aaagagctgg tttatggtga agacgatgcc acgcgcgcga cgccgcctac ggtacgcgag       900
     ctttttagcg ccgtacggaa aaactatttc cgcctctatt ttcactatat gtatttcaat       960
     atcgcccgca ttctctattt gcaggtcgat aacgttttcg gtttgttctt gctgtttccg      1020
     tcaattgttg ccggtacgat tacactcggc ctgatgacgc agattactaa cgtttttggt      1080
     caggttcgcg gtgctttcca gtacctgatt aactcatgga ccacactggt tgagttgatg      1140
     tctatctaca aacgtctgcg cagctttgaa catgagctgg atggtgacaa aattcaggaa      1200
     gtaacccata ccttgagcta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page