(data stored in ACNUC7421 zone)

EMBL: CP000247.PE436

CP000247.PE436       Location/Qualifiers
FT   CDS_pept        470752..471072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0443"
FT                   /product="phosphate starvation-inducible protein PsiF
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68474"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1N3"
FT                   /protein_id="ABG68474.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
     atgaaaatta cattactggt taccttgctt ttcggtctgg tttttttaac caccgtcggc        60
     gctgccgaga gaaccttaac cccacaacaa cagcgtatga cctcttgtaa tcagcaggcg       120
     acggcgcagg cgttgaaagg ggatgctcgt aagacctaca tgagtgattg cctgaagaat       180
     agcaagtctg cgcctggtga aaaaagtttg acgccacagc agcaaaagat gcgcgaatgt       240
     aataatcaag caacacaaca atctctgaaa ggggatgatc gtaataagtt tatgagtgcc       300
     tgcctcaaga aagccgcctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page