(data stored in ACNUC7421 zone)

EMBL: CP000247.PE44

CP000247.PE44        Location/Qualifiers
FT   CDS_pept        47006..47293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0044"
FT                   /product="ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68086"
FT                   /db_xref="GOA:A0A454A0V8"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0V8"
FT                   /protein_id="ABG68086.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
     atgacttctc ccgtcaatgt ggacgtcaaa ctgggcgtca ataaattcaa tgtcgatgaa        60
     gagcatccgc acattgttgt gaaggccgat gcagataaac aggccctgga gctgctggtg       120
     aaagcgtgcc ccgcaggtct gtacaagaag caggatgacg gcagcgtgcg tttcgattac       180
     gccggatgtc tggagtgtgg cacctgccgc attctggggc tagggtcggc gctggaacaa       240
     tgggaatacc cgcgcggcac ctttggtgtg gagttccgtt acggctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page