(data stored in ACNUC7421 zone)

EMBL: CP000247.PE441

CP000247.PE441       Location/Qualifiers
FT   CDS_pept        474450..474641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0448"
FT                   /product="hypothetical protein YaiA"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68479"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1Q1"
FT                   /protein_id="ABG68479.1"
FT                   /translation="MPTKPPYPREAYIVTIDKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
     atgccaacga aaccgcctta tcctcgtgaa gcatatatag tgacgattga taaaggaaag        60
     ccaggacaga cggtaacctg gtaccaactc agagccgatc atcctaaacc agactcgttg       120
     atcagtgaac atccgaccgc tcaggaagcg atggatgcga aaaaacgcta tgaggaccct       180
     gacaaagagt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page