(data stored in ACNUC7421 zone)

EMBL: CP000247.PE443

CP000247.PE443       Location/Qualifiers
FT   CDS_pept        474899..475576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0450"
FT                   /product="AroM protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68481"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1S7"
FT                   /protein_id="ABG68481.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNHLAHVSRRKVERDLQGVVEVLDNQGYDVIILMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEELLTVQAQKWQILQKPPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFNQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLM"
     atgagtgcgt cgttggcgat cctgactatc ggcattgtac ctatgcagga agttttgccg        60
     ctcctgacag aatacattga cgaagataat atttcccatc atagcctgct ggggaagtta       120
     agccgcgaag aagtgatggc ggagtacgcg ccagaagcag gcgaagacac aattctcaca       180
     ttattaaatg acaaccatct ggcccatgtt tcgcgtcgca aagtggagcg agacctgcaa       240
     ggtgtggttg aagtgctcga taatcagggt tacgacgtca ttatattaat gagtacagca       300
     aacattagta gtatgaccgc gcgtaatacg atctttcttg agccgtcgcg gatattgcca       360
     ccgctggttt cctctattgt tgaagatcat caggtggggg ttatcgtacc ggttgaggag       420
     ttgctgaccg ttcaggcgca aaaatggcaa attttgcaga aaccgccagt attttcattg       480
     ggtaacccca ttcatgattc ggaacaaaaa atcattgatg ccgggaaaga attactggca       540
     aaaggtgcag atgtcatcat gctggattgt ttgggattta accagcgtca tcgcgattta       600
     ctgcaaaaac agctcgatgt tcctgtcttg ctctctaacg tattgattgc acggctggct       660
     gcggaattac tgatgtaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page