(data stored in ACNUC7421 zone)

EMBL: CP000247.PE45

CP000247.PE45        Location/Qualifiers
FT   CDS_pept        47352..48683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0045"
FT                   /product="hypothetical metabolite transport protein YaaU"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68087"
FT                   /db_xref="GOA:A0A454A0V6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A0V6"
FT                   /protein_id="ABG68087.1"
FT                   /translation="MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYVLVMIGVALEQLT
FT                   PALKLDADWIGLLGAGTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVS
FT                   SPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGY
FT                   WLYDVEGGWRWMLGSAAIPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVA
FT                   FDEEQPQQTRFRDLFNRRHFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNA
FT                   ALGNVVISLFFMLGCIPPMLWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMA
FT                   FAVYAFFSGGPGNLQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGI
FT                   SNTMLMGAGISLFGLLISVAFAPETRGMSLAQTSNMTIRGQRMG"
     atgcaaccgt ccagaaactt tgatgatctt aaattctcct ctattcaccg ccgcattttg        60
     ctgtggggaa gcggtggtcc gtttctggat ggttatgtac tggtaatgat tggcgtggcg       120
     ctggagcaac tgactccggc gctgaaactg gacgctgact ggattggctt gctgggcgcg       180
     ggaacgctcg ccgggctgtt cgttggcaca tcgctgtttg gctatatctc cgataaagtc       240
     ggacggcgca aaatgttcct catcgatatc atcgccatcg gcgtgatatc ggtggcgacg       300
     atgtttgtct catcccccgt cgaactgtta gtgatgcggg tactcatcgg cattgtcatc       360
     ggtgcagatt atcccatcgc cacttcgatg atcactgagt tctccagtac ccgtcagcgg       420
     gcgttttcca tcagctttat tgccgcgatg tggtatgtcg gcgcgacctg cgccgatctg       480
     gtcggttact ggctttatga tgtggaaggt ggttggcgct ggatgctggg tagcgcagcg       540
     atcccctgtt tgttgatttt gattggtcga ttcgaactgc ctgaatctcc ccgctggttg       600
     ttacgcaaag ggcgagtaaa agagtgcgaa gagatgatga tcaaactgtt tggcgaaccg       660
     gtggctttcg atgaagagca gccgcagcaa acccgttttc gcgatctgtt taatcgccgc       720
     cattttcctt ttgttctgtt tgttgccgcc atctggacct gccaggtgat cccaatgttc       780
     gccatttaca cctttggccc gcaaatcgtt ggtttgttgg gattgggggt tggcaaaaac       840
     gcggcgctgg ggaacgtggt gattagcctg ttctttatgc tcggctgtat tccgccgatg       900
     ctgtggctaa acactgccgg acggcgtcca ttgttgattg gcagctttgc catgatgacg       960
     ctggcgctgg cggttttggg gctgatcccg gatatgggga tctggctggt ggtaatggcg      1020
     tttgcggtgt atgccttttt ctccggtggg ccgggtaatt tgcagtggct ttatcctaat      1080
     gaactcttcc cgacggatat ccgcgcctct gccgtgggcg tgattatgtc cttaagccgt      1140
     attggcacta ttgtatcgac ctgggcactg ccgatcttta tcaataatta cggtatcagt      1200
     aacacgatgc taatgggggc gggtatctcg ctatttggct tgttgatttc cgtagcgttt      1260
     gccccggaga ctcgagggat gtcactggcg cagaccagca atatgacgat ccgcgggcag      1320
     agaatggggt aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page