(data stored in ACNUC7421 zone)

EMBL: CP000247.PE450

CP000247.PE450       Location/Qualifiers
FT   CDS_pept        complement(483242..484468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0457"
FT                   /product="nuclease sbcCD subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68488"
FT                   /db_xref="GOA:A0A454A1S3"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1S3"
FT                   /protein_id="ABG68488.1"
FT                   /translation="MLFRQGTVMRILHTSDWHLGQNFYSKSREAEHQAFLDWLLETAQA
FT                   HQVDAIIVAGDVFDTGSPPSYARTLYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDI
FT                   MAFLNTTVVASAGHAPQILPRRDGTPGAVLCPIPFLRPRDIITSQAGLNGIEKQQHLLA
FT                   AITDYYQQHYADACKLRGDQPLPIIATGHLTTVGASKSDAVRDIYIGTLDAFPAQNFPP
FT                   ADYIALGHIHRAQIIGGMEHVRYCGSPIPLSFDECGKSKYVHLVTFSNGKLESVENLNV
FT                   PVTQPMAVLKGDLASITAQLEQWRDISQEPPVWLDIEITTDEYLHDIQRKIQALTESLP
FT                   VEVLLVRRSREQRERVLASQQRETLSELSVEEVFNRRLALEELDESQQQRLQHLFATTL
FT                   HSLAGEHEA"
     atgctttttc gccagggaac cgttatgcgc atccttcaca cctcagactg gcatctcggc        60
     cagaacttct acagtaaaag ccgcgaagcc gaacatcagg cttttcttga ctggctgctg       120
     gagacagcac aagcccatca ggtggatgcg attattgttg ccggtgatgt tttcgatacc       180
     ggctcgccgc ccagttacgc ccgcacgtta tacaaccgtt ttgttgtcaa tttacagcaa       240
     acgggctgtc atctggtggt actggcagga aaccatgact cggtcgccac gctgaatgaa       300
     tcgcgcgata tcatggcgtt cctcaatact accgtggtcg ccagcgccgg acatgcgccg       360
     caaatattgc cccgtcgcga cgggacgcca ggcgcagtgc tgtgtcccat tcctttttta       420
     cgcccgcgtg acattattac cagccaggcg gggcttaacg gtattgaaaa acagcagcat       480
     ttgctggcgg ctattactga ttattatcaa caacattatg ccgatgcctg caaactgcgc       540
     ggcgatcagc ctctgcccat catcgccact ggacatttaa cgaccgtggg tgccagtaaa       600
     agtgacgccg tgcgtgacat ttatattggc acgctggacg cgtttccggc acaaaacttt       660
     ccaccagctg actacatcgc gctcgggcat attcaccgcg cgcagattat tggcggcatg       720
     gaacatgttc gctattgcgg ttcccccata ccactgagtt ttgatgaatg cggtaagagt       780
     aaatatgtcc atctggtgac attttcaaac ggcaaattag agagcgtgga aaacctgaac       840
     gtaccggtaa cgcaacccat ggcggtgctg aaaggcgatc tggcgtcgat taccgcacag       900
     ctggaacagt ggcgcgatat atcacaggag ccgcctgtct ggctggatat cgaaatcact       960
     actgatgagt atctgcatga tattcagcgc aaaatccagg cattaaccga atcattgcct      1020
     gtcgaagtat tgctggtacg ccggagtcgt gaacagcgcg agcgtgtgtt agccagccaa      1080
     cagcgtgaaa ccctcagcga actcagcgtc gaagaggtgt tcaatcgccg tctggcactg      1140
     gaagaactgg atgaatcaca gcagcaacgt ctgcagcatc ttttcgccac gacgttgcat      1200
     agcctcgccg gagaacacga agcatga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page