(data stored in ACNUC7421 zone)

EMBL: CP000247.PE451

CP000247.PE451       Location/Qualifiers
FT   CDS_pept        484634..485365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECP_0458"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:ECP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABG68489"
FT                   /db_xref="GOA:A0A454A1R1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A454A1R1"
FT                   /protein_id="ABG68489.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEP
FT                   WPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVTFVACVKHWSPAGMTAWCRPCAVQG
FT                   IVFQPAFKALLIGRRAGLMIS"
     atggcgagac gtattctggt cgtagaagat gaagctccaa ttcgcgaaat ggtctgcttc        60
     gtgctcgaac aaaatggctt tcagccggtc gaagcggaag attatgacag tgctgtgaat       120
     caactgaatg aaccctggcc ggatttaatt ctccttgact ggatgttacc tggcggctcc       180
     ggtatccagt tcatcaaaca cctcaagcgc gagtcgatga cccgggatat tccagtggtg       240
     atgttgaccg ccagagggga agaagaagat cgcgtgcgcg gccttgaaac cggtgcggat       300
     gactatatca ccaagccgtt ttctccgaag gagctggtgg cgcgaatcaa agcggtaatg       360
     cgccgtattt cgccaatggc ggtggaggag gtgatcgaga tgcaggggct aagtctggac       420
     ccgacatctc accgggtgat ggcgggcgaa gaaccgctgg agatggggcc gacagaattt       480
     aaactgctgc acttttttat gacgcatcct gagcgcgtgt acagccgcga gcagctgtta       540
     aaccacgtct ggggaaccaa cgtgtatgtg gaagatcgta cggtcgatgt cacattcgtc       600
     gcctgcgtaa agcactggag cccggcgggc atgaccgcat ggtgcagacc gtgcgcggta       660
     cagggtatcg tttttcaacc cgcttttaag gccttgctca tcggacgtag agcagggctt       720
     atgatttctt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page